``-@0 C0T7QT" 3  R @$( U|R ``` ```@``ᆳ (OР iHMP  H4P OР iHM  H4P OР iHM! H4P wHOР iHMp! H4P WOР iHM! H4P 7OР iHM0" H4P 3hOР iHM" H4P )(/ /  /}  /  /  /  /  /Q @-xРР!HРP L8,,0 SZM 8/\ ȼ@f|g`8/*/0Od@P TP  Q:< 80QR:/`<`<KFhkl#Qll3iFjFpGKFFh[k3Hh+:( !Bk($HB%=@IIHB  Fw#3h+ Р4"h-(GFKFhkFdddeݯdpGpGFFH++3h*((M@HAIF h?Lk?HX` #``#h``ah#` h.=KFh7N#h!B#hk`l`h#`B#hPl`l`h*2h#`(8Rh*4NF6h'NB#h``h#` "KFh#hZ``(F62x **JZ`0Az#h1 0` h0A#hh#`*2h)2h* NHFh A#hR`dd@fATATBT ATF#@B(Q0F#B!((A&vB00Fh( I>( h(HF{ F0 ddKF20hhGF00RA-@ R A A A A  A A AA / RS̴ P/@- R+1; R- ` R<\|Q RQ`r l 0@P`p 0@P`p/0@$$0@$$@/l\0@Ѥ0@ R \, W R-` R<\|.4 RS<$DL%T\&dl't|( ) ,Ġ̌`r .4\<0A R-` R<\|.8 RS8$HH%XX&hh'xx( ) ,ȠȌ`r .8\80A R-` R<\|.< RS4$LD%\T&ld'|t( ) ,̠Č`r .<\40Aa pGKFh HYk/ HKF3h)HKFYl$HKFlFrd~dddKFlZdl :dFpGKFiFZk#@FKF[lJ3 `FpG@`pG pGKFHAF7dFII"(F}kGHk&lAE7?KFZhlklk @HA6j"kak>HA0#jbjj=685R03y1h*H*{*H)h*w<4 x:#B + xK"xAH@fdAf@f^dV'ddHAfdTAfUddddddDAf@fd2dQAfddddJ!xKB*z3x++s# i Fo;o;3o ;3h3>6! x ;3x"2h ,  +&3 +'$dB#BSH@SH@| + W$LK*@j#  CC 2`E + BBB{l++:H9H;3h8R0?<=45 )hh: 2)c@ B Bр @B"@B +JG;G!H@<;G;G; +YcgFQAf@fddd dCddFJH*/(-#E@B+!?H@; Fkx=+ . +xf+Ѩ!@2#B65/H@# B<;43!hhB7=5((!9) h x J h)=(ڃN0*#h?#I2+ E( =KI@I 8|;3"hh H@=8 Hddd)d(d0ddCddF'BF(4Ep!h(? 7 h?eBF#%BH*`B )@. #:14$h H!@G%(FH*D(?dddF" #B+#h+*#-0&7X?706B0s #)4$hH!@JKFh3G#F!+H)NdedpF"$Bє3hI0@C+hDlB kF"w$ @FpDkF"! iDeF *d(ш4H!h){ F4#h1(GFUd0!F"B є3hH!@KFhG" F0dpGpGF+1: 5G+x +KcA`BFKXpG tdhx* *pG3`KFh*BhH@FFe'LFD x /+{+##p0? ?#?BH2!@$ @B#DF")i ?1 ?!H@ I@onh!(G(+ `ddepF )X(!@ ( 3) @Fp @B 0F@hnhk ih`ieibi_ j\`jY V F0Fh I=+x+X `( K"!hB#T35`c`F *\BњB5\(!\B 32 pF+dF h! &a`x ) )(#) !'x()x )"3b`+`F3093 ())"*#2!v# "!o'K1h) h?(shc`7~dpF "iFh( !hH2@~ @B@Fp+`FeF"iFhu, )h H:@^ @BF "!(@0`(j 6e0F)H@@ @BAtK"A(`ycx"x yxxI(@  F0 FdfedLF%DK ")D@")&%D #b#kB#ckBۡH)`i( Ѐ"1uH1 (?:"( KDFhH+Уi + АM 3*F(ڌHah@()"3hJ! @r( Jh#'(ڀHj~H)}H)|H){H){I3*%@_j vI(?}!-(#+pj#ei@B1-X"76DF(?%?-?5"ai-B"_H?%??[L")2 @;"!76D-PM)6?3%6?96?5"1616H DH1@8H)z#i +?f i?b-5((8H@M#i6J )@ 3H)V(i&B#jB\  $+4+&H); ++$((ъ"!hF(%e+ed4eReaeeeeeeeeeeee-e9eeTeeGH)PFH)EH)DK .CKBK +?K  j?>K ( #j9J8x /+9K j? ?-0?5? ?] ??8 (H@0I K   J#j9@.)J#0,-.#i+(ahH@(H)g+4.K/_ege~eeee"e=dkeeTeeeF(" UFFh0' 1hH:@ F*11H@ *)FAd^dF+#H!@$dB'7a?:~+ +1+HI*@b#4C33ڽb111 1 D S!D"D)( " H@*($i+1<31ac*d`" $ (ٱD<<W"+ +sh+ hh?kp`( $e)1M" `H?) 1=9]Ih??$0(a(!?##p)1"i+OIhi?7 !8?Xk9a?iT,v Fi+m)1i+b)1+j+[) 1kj+T)$1)#41+c)(1#cC" g (6D&5:5 55555$555  -ph(Pu`,ڜ?#C33ZH "$Melee"dee0Fh!`h`ih#3B  F0<8(-hpF "!C#3caa#*#)0E( $ @FpFh 0 !C&AK3"i hJBG<>S!I0 ?O21(((* Fah)ph>(+;<;Xh>(?h ((0ahH?>7ѱ!`tddHddF"!x Cc`&``'s-(>u#B(> a( @B H> a(#"i TF/!(>^(C3 eF H? F.#a!( F:!eF@"hF>iF @"=bh$ C$!@ C!  @CCBXAFFh %-C$(@$ !@C C#1@1[ =i C)@ C"@CCBXAF#@0X*pG3F B70@0X& C6'1@ ? C;@C!*` B 3[`FX5FfFCF&63@ fF:@3CC3"C#+`h+ pGB 00F (Єh F0KFKIFFd)dKFKIFFddKFKIFF,d4dF 1` ,!HB!I? [3`I?  B؀# [cH?, ,H!?& @BF  :&3(  : Fdd dd*dKFKI[FF$ddQMF 3 ")MH?k)LH?g N`Zf2&6AH;?N)@H?Jh'?C:@ C3@Cv#i8H C9@ 3@ CC)?.ci2H C9@ 3@ CC)? "C)( )&&H?BF1 2)H?7+.H)?6 +h#i C8@ 1@C CIRC8@ C3@C@9 H?edddd!d7dMdZdjddKF#C?LK` FF>FKF(KhF!?F3B #*І F09?(AH= @B1>H?3h  C@ C!  @C7J4$h6HB0(3H 0B, /H0 (,H,H3+ sB+-ѳ+($K?.3@3h  C@ C!  @Ccl+с+|!hH?s hjF!t` `qFeddV'ddddd7dRdF)H ((!?B,c4`*!;`= ,#3`;`,Ѐ"R)+=g0`(Hn @BF=j*:` H1h?#0h[*!HR5dAd]dd @BpGpF653h)h0)0(*)h3 m@Fp0F!H?J !=7 F0BdeFh h0`(\hhBѰllFKFM`@` FpF@ P@"1C"Yi2Za3`` `0i(&ChD` `c``(@Fp %mBpFI !Ch?> 1P8+` @Fp $dB璱dFh+l @BDgah+3&J!8?$J`b(8Ыh j)a(%ѩhh+у#b#+ah+Сi)t(#b I8>_3#b(.F#b j!m ձddݱd0F !9(3J) W F0Fd0FKJ Ch2!?k kT(  F03> ) (w @BFddpF <0<( @B@FpIph>k(qhB((#`FdF!?I(C .H)?;&vB0Ft(6?8%H*?&&h,<"3,2B3УlBj! (# 8( ( K J2![h > ( `FddddFhk ;h+ h0;h2) GF& @B0Fp hB F0KF FF h EH> F+2h#C3` k!\i+ 3[BB3H(;>c($dB8 !(Q33)>P!K>,<((B$У4Q K"8<<,#a7ba8hЅ`$dB~ $*!H>ddeq7`d0Fh +h "@l`+,Hah> F0H>FUdmd0F 8"!B#[B%`b F00Fj k F0F%'ci22"kl3Уjaj3bB/ڛX``h!(!`al3&3#h;B#bh`#`#a#h)@+Bii3aB  @BF#bh`h"i3`B"jX0E(1 gpF (#C1 v ( @B@Fp6 !C (ѣj"kX `9`h*!^(l3&3#h[`a) aKF  FF!@"B#&a%bbF0F@j j k`k F00Fi+ChhS``#`C`hh S``#``  F0KFj+ju( G @BF0F j ZhIjH> !H> F0ddKF@hsu'(8CBXAK@B@FHKF@h]_#'(KFFKF#BБi(FKFhkZhАGFKFhkh+ИGF& @BKFhki+ИGF& @B0Fhkh,G F0& @BF4(@i, U#[B3! (1# 3&[5#BBB&b !( .5ZP3-;c}bF #pF*JI !> k=Q c((1 =( -c#b(7@Fp %mBFeeFkB#y*!"#0k(( FB * T#buc$dB $$FLi ,  !((!0(O( :h+B!(( "#0(K(;` F @BKF^ FKFV3aCa F0FIh9`h6# i3B F08KF0h(HFF|d0F o(`  F0F(F8# i3BKFF[h F #+9 ,JKMJYCBkh+ 4D5KFXmJI(.hH "1=( 6#[B#2)(к\8f""`*@FpKFK` F4eF  (#ci+Уi+!fi.0%*B=*h K1 ( /kh5+F @B!"I 4J#!8;+!8;(%J!8; 6 CA 2 <( HH+>K!8: dȬdd#d'dFh +ѹ h(9;(\HK F "hWH'(2>B ")<-rNHb"R!+"1(;(p@Ht5 IF h2 h[h&FhYAB B#'BBcF"R!<( )BA+#"#!C " @!C " @Ck`KFbDH)>. ` ` h+ N H FdddŰd/dHdddF !` `B' 9(9cl+J+F!haH>@ hjF!+9[H1>209=(јWHMh>.ݨh(!>((fMH n  !JH> HH ` 4(EH! F L(@H@H I+>H=H+'@78>9(9H,!ih  C"@C @ CBнB1C2@ @ CCBS(HB҉9(=.$H!>&"H1> `sh C@ C!  @C `sh  C@ C!  @CBHTldddd.ddcdddddd֭ddCd̮d pGF  ( :H>O%mB9H>J(F ^(3H A(1Hl- (=#-J-I+  ,+ch  C@ C!  @C!Z1 H= 8a*0HcA= p$dBFddF3V.5`h>,x+-:++#+)I`h ">( hH)3hB H=v @BFI#3$9CA#KK2e@ffd0F H'!N F0Fοd0FH!=6 (2H #h  C@ C!  @CJHB K(H o F0 H e ^( H H [ HMdndV'ddddddF* Kh F%$/X!=h(<5BH1"h=H#bh;H#4.ch&+7H)h6Hih5Hh4HKFh=2HKFk1HKFl "/I/H=?!.K=,IhF0(!(A/H*)= =6(' =!)H= BAd G%H >$H=k#I=s"I=9<8<H )BH)+4XF~dd?d(edNd|dTFfdd d>dAdgdDeTBfddd"(<+x?+!C  @C" @C3`63[+H)33x *М5[*+3D%x]+0x ++4XBJ\+Bx])B}<30p6;4F(;0XB#hhxg+#+h+xs+ki)i0hh8xn+s+L+I!0h8!0h8xn+1hi!<%mBB3ZBSAxn+ B !0h"8^8!0h8[xs+i8%{#[BcH3 ;0$By!##.@B- :Hs8IY<.6Ba+4I<"s+8.Kp+ 'l++I";u(h0h80h+h9R8Kw '+Ыh$+h0h80h,])"8-(#"H< K$d+ddedd e9d>dƼddde-(!H<)(H<"0h)8PB ( x+ IH <4,HJJ5L!h:0;(W h;2BRdh-$(;,1 @' XBXACAZCC)})x, @ CBXA B  BBPABPAK4B1HKh=H!.;-W;H!h; &9H (+Ф!x5HI5O(;x-++nB"8;B `#K`F"H-#`+6!;-#`+ !;.-#+!;.#p+!.;- H!h;!.;-! HFfFfFfe e"eetfeeHF* NF @BHF* @F @BF;+;8h! $,!xh;K"h!h;F+h!;<-@b-`3b- 3<$ Fp[$dBFFfF*)h !`h;O!;hh;!?hh; H Y FrC?$  @BFFfmd0F ;x+px-*0!;l#p F00F BB H;cA)@hH; F0H;FdddF*dKx2p[x'sp K h;pK huKhpKh#pKh#K h#@B)`hx3p:(ch[xsp- #h9}-" ht- i!;# -  }+٥I"0:(ТH;=#[BF`i!;3xi+C-K,(сK H !:4$$r+i;x #xB]gKxpRxZp "dKRx`cK`bKx`"aKRx`"_KR`^K`} #"RB*!(^H*!:#5--# xB BзBTH:4$$ BѷBNH*!: #KH:|5w+'Hk@  "@ :W k)2+с 1 b @ @ @1I@(Ѐ%0IB/I/H "!:8%H:5 3+'!(`k"A"%IB$I%H: 'A@ * +!(GI/I/I *!(8I"09A(н-hdd:dedd@djdE4eged}ddddddddpF":0`B @B@Fp x-* HJx*"!:p +`x*F *_[hxKhKhKhKhKhKhKh թKxhh9((kh"[xx+$Ѩh(ЃkChh+Кj*w*[j"+ tr+ ѕH  F#tr+w+5,%`Y!:>4 ,NУ^Y.!09(8Ѓ19) #STG^(0>(<,%У+بh,Uh*(l+ #[B(hk/^Hh (Ї;83X  B=6 B+";k1#8G(й4B![hj#1G(Ц4B+" O(Ж4B3 3H!: Bڂ;83X-H1:u B66+j*18G+ )  H:X[[h*\j1-H):I"H :C3B5  @BFFfFfFfFfFfFfGfGfddddddd/3<4      r+vw+q Kp K ` K ` K ` K ` K ` K`K`GfFfFfFfFfFfFfGf 9X-4`h!:c'.!GC`h9F4d %3x+ЦB9:B 0; *CC !6>% (d09 @B F(ЃBӄhJ#z+J+J+JcziH:s i1$3hB4BFFCmeleeee0FhhB F0ChhS``#`C` ^(-h0F ":."hxg+K+M+G+ F0k+m+у C 2C"` C0LF%h-#J!hhB НBKHx  #3K hxlHЉh F0  )HH)GfGf GfddKpFhNM,"СhJ z+J+J+JHKzxI:0p"(9@Fp!0a,pFGfLe$GfCmeleee GfMdFbi6 Bq``N`a3-(K'hB'Kx#ihBciea.`k``iiiFiBaE C Zh]`+`j``2/:H:L FaEBiiBњiiBJx3pW FGf Gf e0KFFZh#@ HB# F0"!#h0,dIF љ C I:F C Iљ C IIeeee0F0ch"h%S` `%`e` KhB I hB` F0`KpFGfGf GfiKFhgLB##p%dOhi9FBٲh i>e:#+pi#l3BRKhB/ѕ;""p?4hBKI%%p xKHB$(Fii32isiQ9Bl >-7CC3{+Ѱh9BSc(##ph>e])#+plsj+/>r##p;cp?4B/1,##p?456hii*ikiKAiBiB9ZCB c@##p>\K"%pH!rFGf5GfdNF4h%hB $`d`Fch"h S``##`c`0i ,-hFGfKFK"pK`F5GfGf8FJ (JXIhF:mhF K `B HiF: F FesdidndF ii i1ai1AiiA aaa}i>iBѲB gHi:Q# F iaiYABѐB;z]I+]I+\I+\Izz\Hh:1BѰBٹiWH:'#yz8z{()ib+m+gii +>);zBI+AI+AI+@IzzBH81ci i)i +> );z2I+2I+1I+1Izz4H 8km#SChh!FaE2B;z I+I+I+Izz"HiiB)Йhv!D"iciKAh1h%B 60BъB+AB+`h8b(9x3p6h9x)H9x$x (`( <$I$,KXH91 k8` H9,`p FGfd5desdYdndLMFD,h,K"`[`K!H`[`=J!H="H!=K"p*`M("$H""!="! =,"! 8/ѬO(9N88(٨H!9 M+ џL#x+ТMH)7( 8!BӝH#pH9mM+x+ъN 0hhB+#+p3`@` (x+++9ЁH"98X$9(8}N3x*Ю+Y #DFChhS``#`C` J $h #* U( x=* sH9bM(hhBv]3.x #x0b(ѐhh,!8M ( 30 +\H8HCHM*h)hB  3 RHzB[zBNI.NI.MI.MIMH9!=cr "aca 0Z&ra8i;"p$`d`khl`%`c``@ChhS``#`C` $hz+(2H908 C +x+ЛH"(8K%I " 8( 4 ' x,@/_M+hBhHFGfGfGf6If5Gf$Gf Gf eLeR e ec ed e e e eٻdCmeleee/ ei e e e  ,Уhz[z((#I-"I-"I-!I"H9 "kKZh\`#`b``"08K*h`Kp a,I(8(\ "(i(Б K` K"xpFCmeleee eGfGf Gf$GfpF(-H9$ @FpkF`h*-K` K-xph Iz+ I+ I+ IRz+ H9|FdGf GfCmeleee5dF*2ѿIXh8!H!H H!K"pm Ihh8| c!HFW( @BO(,tѨN4hB<#hBѦH9N0h(!ФM)x\3hIhz+РI+РI+џIii+xRz&igiHh9H9IH9H IH FH ChIz*ЊI*ЊI*щIZzHi9H9%i'#3B$hkjii9*ikiHh97-hH9c+ٖIhh"8t$&lDnDh#2(rvJ1x xhhBsHh9e4zBtzB.аi8h8$(i84$$0$hi$$(8(4$$`H?,Lhiih,i(\H]I97!(*,'Уh&iYzz9KhZhB 8KL``8K!`b`p``\`#`b``h1( G 1((k(;H9,9Ihh8H(h"jD (+((KhBS&ch"h S``##`c` ;.ЦF ,e edLe GfdGfdGf GfCmeleee5ddR eddc eedddlddGfdde ddFdN(1x (ЄB H9#3piiBѢiiB&3x;H! GfJd}dF9(.(&jF20(hz BH9V @Bii"`c` iKi*`k` iKi `K`h[z;`F"hch B B H A  `K` *`k`neeF(#"*`k`#`c`3`s`$Hh8 B6B3HP F8h#*i(+xh!9(Hyh8 @BbhshB"h3hB H ,hmhH"+8eeeee0F( M+hB Kk!8H,` F0 @BFel(eȩdF .!81I8(0I08(.I08(,H18i Fk:'H8_kihh #(:H (( h  C@ C!  @C@3 hh( :3W( K`YHeeeee e8 NIMINH8sA*DI"(7;(z8I"(73(+h8}?I(7?{i9i;#8"38  H"87#NH!8-+Hi-yxbx!xyfy&yxH84=}i- -{xbx!x { f{ &{ zzfz&zyyfy&yxH84=I"(7%(V#+!h8oK"(71(ЙIH8.!(7(ѪI"7(УI7hh#( h*((+6 i8(0H!i8yI"(7(zI(7А4+~ h!8 #8A(x2nH8c&=4-ъji!PC) BdHWpBpAiRSC@#]I7t( [I7n(YI7h(е().r(NAJLK,KK!hh 1#( (`K(Y+" !{ABB !, -i!(`CA,H !8 +#;2( {CA+i#$_A&!(JF1dPdbddhddEddddeyddeeeedIedޭdI7"9?+82;( ;,!ГI2;H8HJ-яJ82;( C2;8(jiigAHd}H8|I(7(+"h8Y "h8Qyi8i<kH@++iH8"R8<B&=imB@&(B@@"! <(:iSB @%!8``"aea 'BLڢhhSH18&ixiR8P(LH8~ &vBB8X(34! " ,/HWh7H1(i7Chh6 (%hh'I0"6,h29]h2#H7hi729hh29Ihh"6,(i7!h7h",,Eddd*dd I h) H7F L*\h %(!H77Ifd=ddKh+H7$ * @B`h7bhBХh".h7hB9(&?()H6IfKddp M+h+'H#+` 'U#(J`pFIfIf*Xh @BKhpGFIfL#h+H6 &(K ` `FIf"dIf* @B ( ;  K K( K K K K K K K KFeLee ee*e2e?eCe\e0F ( ((B%H6f F0#H6`-- H H6W H,H,,HH6Jh(;H6?H6<H,HP,,HHHHHHHzK6eTeeue{eepeeeeeeeeeȽe̽eսedF5x+J+z"#3h\<'7  1&6)H6064#(3 3(.#H16ky+0 H6hyyyIH6#B#@|H6# $$yH6F5(5("#3\ K6Fe,e9eeceeDeF 5TN)SH6kY :Y 2>(ѠY (_ѣYi %t(cРY <FH6N+/; "p!h@H6A #zU)\37T#;p"#3\ch7J;+5JX#3~3H[6 #35y#(3 3(%+H)6 )(H6Y b$(F (# [H65I(5D(Cl#B - (  ()0T#;p 2, deeexsdeeˆeeF "!hF:iF , F0FiFt %( F0Cl+BhF  (Cl+B GFɰ) $#lDC"3(H!6hIFe44FayKH6Vy!yIJCIJIKIK&zIHv6Fy+ FH6@(yCH69,4#4+33[z=NB06)F!x8H6!xax7H66H6by!yx06y+ 0H6 (y06&'# 6 7yB433x!@#J#J#H6sx""H@+!HB H+ H6yy;y CH6sx"@B1yH6 H6 63 7F;e eee%eQeeeoeeee7e4ežeeedܾeeeF ,KX $(FCl#B J(  E(  , pFEiFv D( @Fp&h,<"3,2Bcl3Bj,< hB (cl3B hBIFIkF heKF( K`FeKFHoFm`pF* @B@FpIXh"5<( ~Kx+}H6 zI`h"5*(xH6&vI`h"5( -rIurH6iKoHx+ёnI`h"5(kHiI`h"5-fH h6H!bH6 8`Hэ 6\I`h"5Ё-܇h6'SH16 {!h6#X!iMHBxS( E(F8 ( :E 6 @ ;f8 +AHAH6W$.51?H6P+hn!C C"##$4Cd $$  ("0$1H630H6/$/H6*$-H6%$,H6 $*H6+hn!C C"3%H6$I`h"5K( Kt"!(d Ofd4edddd/d[,e`dd`rdd@eddgdddddd/dHddddde𵝰 *t*/!Xh6J!.ѹh&(?()[h -H6#2 B (H6 $$! J(7 (H h!C  @C"  @C+?3):m+1B rsB qC:m K`9hH @BFrddεd. (Ff)Yx3)4:I:`h43(%%mBeD.fKFBCAFF* @BFIXh "<(h"1(Ge0F$ HB (!3hBH6 F0 !3"H6,D.fWd^dF*[hx-*[xa+=4!-4&'B5 !  H J6%(F h!(H!h6674ddFh# "' :*7hh,x-*E+\H6\ +# h!6+CUI`h5(=`h!6+n.O&,rKH!66^d*"b*c* @BUr*t*+z3 "+t3"Bx0*%+i3"$B.р#[9]:BRx*4B-H!54+H"!5+ZBSA%%H"93(,!K!Hh!H1 F.АZBSA 5>9"< 7:"9 4 BHZBSA.JFQh# C S` HnF,dedddD.fdf#dSddTd!F'"<,]h3.x-.)  !nx5.a.f.w :),H FdIF*Xh K! 3CBXA F @BFD.fF "kh,x-+ =!5:H5' !5<3x+f+aC1Jh3`,ݫh'+ -I3#0CCA FX5Z70B0 H1*+2F &h+x03!p)2&pbEџB;pK# 9 3O8 BKhH5 @B+deD.faddf{d LFD*5KF[h KDF`hЀ!J5TH"(jF|chJ) "iF 8jFt#"iF  @BFdddIF*"F @BKhpGFeKFK#KF[h  Հ") x+iF FiF d&Fh '5 ;+,`h"x-+4!5 -*!9``+x +N04(4#?B04 ")0Cp4! 42 . 47 5Y 8w!4 !84(в/'8FB*18Y*!4k!4%:!p4B5#B=-44 0L7I5U!  .:#3p,'#T&pCxp-+у=+у%++у# 4(+!.:33p +4n3Y8!04/#{U 4#3T 4$4}Y8!@4pCFdF'()x'B% !4OON(Cx+ 4Q0w!4I(4#(8F#``eF+5 %$  /c;i;+ ) (*+>iB(,&h24Ped&F$# 68. $"!$bF:F0& !6?7BDB@kAB7тB5AC2@"C$ $#@C1C@ 1C"@C̈́FC2@"C$ $#@CaF @B! !0s!%00}&6FcDB FcDC@XC F cD C @ 1@;C C)5C@ 9C2@C!`c`cD F`F CF @ `F1@C C)F`FCF @ `FC2@C 5#`;`𵅰 $%;0 !:07]A +)+ C)@ C) :@: C`"#!C " @C"$ @?#C ;`!C  @! C @FCeF*08`,# J1(/#( h  C@ C!  @C#`Fd𵗰  /  S++")/GQKRI3 @B!17!/( $% $-;@708C7'@6 8C.@0C{++"!  !/+*$& C@ C!  @CYҺ!7."(В "@  B| 1C) q7FFdΚd/ + 2;!(0  2(/(/C*900, /xNI*03 Fdd7//bK3 H'$ >2# J!0(0/FKFXdfdnd|d𵋰 B$ LJ!/'B9/B+90"s#*0 /7K<3`7!0*+!C * @C"- @+C+J(. '#!0\923!C 2 @!C 2 @C #!J0Cی/K3'!00 23!C 2 @!C 3 @C(/K,3c)dddd+ddHTFds./zK3J!(2(3J!0(0 /[K43 vN02! J30(0/CK$Ld)dd\dddds* z(/"N*!03}sd𵗰+ 0I1H#23l$dB .s/(I)K3['O!:(f$K#;(0f#B /K<3;3B CC+(aN!2(09/K1$Fd9dd7edd#diF#9I/(i'5I /% /B')Z# /,N"12J12(&I22(;(0p56- /533C&(I33>0px+506-#%J # J 7 dd}dd-d'd(Q/$B!!(/BB+?!(0 !h/jC"F @bFF#CbF@CJ(:>2CF">@? bFC@>C $$ $$& "0C&2@C @Ck`) 4#*(/a(OK:Fdph-'H3 p(.  .0/ K3 61ki C@C" @C)H"3i C@C" @ C+ ki)C(@ C@HC"3H3##`Fdd3dKdeF( H3$ FN4hB )02($hFeeOfK"`[`K`pGFOfOf0F Dм"!7T$`d` F00F(j+ k+ 5(( H)3U @B KZh\`#`Kb``h* F0`eOfOfNF4hBрF!H13-%#83X/ {h Hh)3 h+ HYh35 -$hH3Ofeeee0FV(K` F0H!3 Ofe0 MF(h(0!2(+h #B F0OfKhpGFOfOF=hBH13 $+83X+h+ Xh12(4`YF4 ,-hFOfeKh(0pGOfF ( F"j3RB)G( F  ,"3'kRB) GF0FH M,hB H Kh) H13O F0!H13G$hFxeOfeOfeeF3" ( @BF߈ KB3") (ۈ;C 2` p"@ pFkF3" b(H2H2)3$;") O(HkF3") C( H/:3@"Bd F FeeeeFkF3" (HH2 !3";") (HkF3") ( H:3@"RB, FFeAe!e/e pG #SC"JC-11+303 x,21x x2#x#@ )C2`g0$3hB`oBg0F $x F0F'$"C*%bp"N pg(Q('Y+8<2,ѫY+KXF @B   0Fh n$ C I!Cd$- R$$ # 3" F0FLF'&D#nDC3"!B( H!2 #DF" H9$2dBh0"16$FddFBh 65*#3r#f3zg+` +) +("+IH2q @B@! 1rfg)`+*2 ( 2X"@+ fF""F$d]eF#%d'#hn ICC"  #(=-F F#- 62#)(#2#)8(#x2#)8('#x+cx+I#h%f\*3ZB\\C+#x"BېCF#pC+ @B+dF+"M `Q ('. KX``Y(рF @BcY>+82 F  K .3@hpG3# F@hnO!C C#[?;&+C"#>B kB]Adbo#@Cbgn0CfFpF'$#lD C &#!](( K HX2? @B@Fp1H25` beeF #!4ppF F1'7} 7BH2 @B !AC~\B a11z )F0!hn C C %@  # " B(>e+LFD$#C/B*@)>#p!KX)# (5#x+2J#[BP#bP! iX#(( }4#ZQB"T#DFB!xFgF?!/a xT4 @B "F$ 1e!8 #1C 3!8&7yH2J(c4 F% &vB;3`kx +ТH21@*x *ПH80)06V;3w|#[B ;3ڊ3B!x)[x+S0+ѐ+;ыH )RH3BX xB6;3.݄HJ($&=5}Bۙ3cC%$tC 0r0w< 86#&33"p42Zp xs#sC'33x2p CdH2bHYBs`H$tC;&22x)3YH^ 3p #ZC)00 8"6-4 4:Sx9] Cp SpKH)JH3Bs3FH KCpC00 86*!85;!33\B4_;hn!C Cd##*~8 " .K.HX.K$X2-dBf8g+H1$;3> "!(66 "!06;H3! "6{) #85=5)|) #28+i|)Ѳ #8"Fedeeeee e.eTeweeee e '#Fh`H2 F9(&+(kh! .`C6d#6 #"(k K HX2 H1/(!(ze e' pGKFX8Ch+h3p KX i.v( H2[#3p#pF8iF, $ ȿeF hn !C$$!Cd$ $ ##"F03Fyh; YBKAn$ C I )3!Cd$"2# F0F hn !C$$!Cd$ $ ##"FpGKFiv8CAFpFh n CICd"`: "#KX(6y+bx#xC#@Հ!I C!I B"C#p cp(@Fp, F#"CN1g"1(vk$dBY9((_#"C'#"1(A XC1S1(z( #B 37/$dB1H2>%"1(6#!@"B H(X1"1(! "BKSA2 "Fe, LFDw%#CKX9Y`")8(1.x . &2)8(%2) 6+yxCq  #r"! 06 "! 06yy3r+kzcs#xP#zyC;3y+ "!8(#"<3p`#@@.Ѻݩ.ѫ .Ѱ;hnICCd#"`;83[(8(&3пKXя#[Bcfz#hv%"XBڲH("2$B 13d.d#"&ca%6#aYBڙ&%6YBژlKh*92`jKhB/#h < ; eJ# 3BУh fh%h1siBҬ7'#C:3(?(ہ 13iBҕ#ihS``#`#a*z"sjzbs+8zs5`.XHKy+QFK#dNEKEK5) [! (#H1 @BK`D`Zh 1`Y``a5`I; { 'C"@B)81 3iB#ihS```'a  hcz CCKJC# # ; +) h"hn C#C#[;c3x#z!#( h8NY hn C#Cl#hQFz CC"}n-лn h J B # #[ 3 hK hX+!"B3#hJPB##hJXՊB ;*   . Fe p#F aK !!j h2=%i+H=1r-ѣi+H1la #{+ 3x ++ CA@B@Fp# + +' eF'&v # v) k{+Ї) +" ,2p#-3*p++(P/ *h:KX"Bj(G @BCk{+: "!05#3p#b3x "[sp#3qsf# 3f3c3)0pk{+)0\/*h!KX"B+Ѣ*2)*b!xH#x++ :F++W *b!x H%-5-x,4$x1 H0n(ڊF ie,eLF "! n5w##p#b3x "[cp#cf#qKf#c3)p +kGfFF@Of`OfF*n"02#X !z4Kp4KfB5-  + #C &L[i "kC!cf f5*##p#b3x "[cppp q#c3p;k9 %rG({h"C{`8n;+!{  F[cnv.FOf@OfF*n0(#X [!Fz4Kp4KfB5-  + #C &L[i "kC!cf f5(##p#b3x "[cppp q#c3p;k9 %rG({h"C{`8;+!  F[cnv.FOf@OfFhn !C C#[#"3FF/# C+x`J R\! @)Ao&c1 xC+1 hzhn;CC CSHTK3`hs`_`'kn:@`3s+b3xss0 xs)051#[ h#2,(  @B(Fch;B0.=+*-3,25xxfH1c{+#s*F+x"@_Kix@"B bs) 1"05) 1"E05) " 1Z05#bw &P2pSrGM "!(5+"b3*pxjf[kp+c3 2p9;k(G&zh#C;C{`"0f5|#3M "!(5t%#+p+b3x "[kp#kf+c3p;k9(G(;+*H1w{h"C{`#3`#s` %C-(@C  @C 3C5@ @+C C3#aKba@YAI[@HA[I@HA[I@HA [@!BIA [a#s#A@OfeCOfe e̪Fd >JX!(`(h?$#Chn5ICC#[;;&+z"#B#x&)J3 ! 0 ##%O L;h"IYt#  {#)Crrs(;h 3;` : F 6B$ I  <F, e(Ofee)j,h7 7B "+;h+( %$h(+;- 3`0(#hB":%h @BFLD(с)~j+|h+/+h+u[h 3`;KD +i+(G+jh* 2Bѫi+@0Hjh(1,j'hB+H0#k`h#pBji;*h_ #$hXhG< h(<?h0((,ch0H0 @BiG(,j'hB< h(<?h0(,  ed5e𵅰Ij5h' 7B x0)(`((( @B/3;h+( .-h(3;.Z`/(+hB*:.hk`*cj2bb```j3b  , .aBa #a ``F`abB (/`( d$ `# 3#bcbpj.h# 3B Ѡh(M J p=(h(B(?56h @BFh))hB:B.1`+hHT*h!0+h3+`#:B4`(h$,10b0/+h HT*h!0+h3+`<, l hFFHdFh+M+x + H#h;#` H#h;#`#hB۵B;h(;;`F3x h + ;@ K#h"C3#`60 `0x$FdneFKFZh#@BbI h+ѡJ `J@B`JM`J`J*QL3p+; `+#8/%#&+.#$ , ,B &>U;xMBK*h ` F&< x! 4{B+/ /M#4$MA(/rBфB @B.i04gj 1GO[,O,\ U618(42a [x[+ p" 0+ ~+ ѐx18(4)ۓx2+p 0;+ q~,f \q # x4>&D \p U, `(I4KkuaH,HHHHHHHHHHHAC[()Mt}y"(/I H*!0W  #<+> "&p <,ѠPfpflfefhfPfHdB8]4&B <Bux+ '.\*"&p=42\. \*^8*к~x\"++#'.$.#\*&p=4#(.9{.7$##p-4%fp=4).}.Y"B+#;'pl#B]* \T2U7B%#< @B%p++аFKFKXCkGFfFMpYkG(pYlGFFfKFi[h FdKF+ i*[h FnKFKXk+ИGFfKF+i*[h FKF+ i*[hKXhkGF.FfKFjG( F0F )%(#(KP,, F0KFo IQ`o J`KFo I`o Iao IQaoJa @Bfi'a(a'a'a'a*dKF(KXkGF @BFfKFi[h FKF Kh+ FKFi+( (K8`|fxfpFmF. (pI+x +45, ?I"0/( @Fp I"0/( I"0/(I"0/CBXA8d;d>dCdKh`pGF|fKhpGFxfK"`pGxf0F(h#@ZA[B@ F00F ()  F0 @BFI/s I /m#(I /f#(JFQh"B- ЕC F9BH!0 FeeedKF" a[hFpG0FHSL!h)HLHIah)HCH@h)H: F01H/1 H/1 H/F+ef+e+e+e+e+eeF%$%'!KF[hhhB%,! [! W-) Q$KYK1Y4J ,JFQh# C S`FH;h:B - B,, B , - ! "! -3feNKF4hhB KhB (BB!(4- 5`F @BFfffKFK `KA`K!`4FfffNFh]h#CK$$ <3$B h[B`B0 h) L K$h`# CS` FhJ- C]`h`eefF(#8Eh'+Cbh!CKI=@hBњ-hhh``#CC`CK`hBBKhF&b`B h@[hF;MEhgF``oh%/Bћh. 3OB CHaa``E`P>h``$"CB`P.р"B [ @Kh#CK`[h````\ ,ؚ 82mh&B&ђ#@KhCK`````,"[2T, n2"RB w2 M~"Bؚ |2hBbhCBheefeTKJFhhC F( 0O("#C33B2Ph9Bh3B(Ch"hCh``Yh" CZ`0#Z ?#**) 83h&BAhC*5;38iIBXBh$C,2#C#CF`}a=a``k`P*[3T* n3#[B w3I~#B |3h*ۂhC``(ya9a,ۂQh# CS`yh!BӥT "@"Cz`h````"@iIHhB%B$CR3BMF`Fh`E0F$0 B#BKhCK`HhRB*h^h#C*VQKhPKh34 C9EJBB1GJh`DJh1`"+@B2?J,$ $ C8J@h`/K"C`h`BѬ.ٽhZ`)KhZh#C*h! CC`C`Y`T ,ؑ 81h&FB%"@C~`````P,![1T, n1!IB w1 M~!Bؑ |1hBahfFCBhFffeeTfefDh&C."CE`hh`2C`Ka a-I``Z`Q.bh#Cc`hh``z(h=;B3RBK$ $$I h `B.6h$4C\`KJhhB`JhBK`II `# >C[h@3CS`"Z``.0NFefff KFhxCuh/0( 9Jh#CBѝCB*:$*#* !3!`a`*١``$* #3"`Z`` F#3!aaa! 3$FeF&0F(;[hFbF#C  3"+ :CB5HhZhB!C5QBAFcD` "C:Y`ShaF@ C&S` CYIhB&!CB!hh``Yh#@,)C@Ci`D`Qh0 CS`6"aFՃ!9 h MihC+rGBE3Bhܪhh``.:6$*23*#h`ch`*+43"h`bhZ`h`ZJ`"C_`kh@Ck`Eh+ahka$*+43#ia+bi 34a!03<B#hh``hh``(:0$**#h`ch`*+40#h`chC`h`!3`-_B0#;[h"C:B_h#CBh+ahka$*(40#i(aci 04a:$*(!*#h`chC`* 13 h`JhZ`h` h`h`$*13#iabi13Ba!3CO`Qh CS`eF9(6 F(%;" 3+ :C(08)3 _8 )3iB0Q$4)0<3)koB@?;+ch!:C9Cx`XhCX`ch0 @Cc`*<ch"C+ ݠ"CC`ch0@Cc`4 pG+'+#!8h/!xh/}#[) -*:)3H/+ h!/d` @BdKFkFpGpGKFFKFpFKFFKFrF +;BpG @BHpGfF( FKlKB %1@8H=.(($h̤ff0F(P! >$ F0P")30F ( IlH3dIdd`, F0 ` @B̤ffKF!FKJ ddpG̤ffKFP"!hF3 I.# K K K KhF K Fd7aw7aY7ai7a[7aKF #I;FFK H$ F.6!8293#!(U(F*4&' h( H!h/ F9C(64B @Bd0FH/( `!HCA F0Fοd{dF(H/v- `( H/hh"!GK/\FdddKF(KF;FF (&0F.!.C((.#sC'&B/!h(.`( h.wB7&4&KFJKIJZCF(0f\8f(0fm۶0F H"i!h. H!h.`i(H@ F0: jFhX.i}(.H*h3 !.]4H!h.W%Fdd0  #FC#B * , K H#e F0,K#hhfeF x#KC +f#3`B 3QB4B.J`"Q*h5h* #:C / )(Ѕi-$4` F :G.!.%(.*$)h`5B(h.B)h:.( 9bBI`$dBF4dFİ h hI - DF->(;xL %-~#)#3x ( (( 5`x(\ ( (X2p -Ѫ#!`BO"Xx$+J;2CBE .C#qK#1u(7(Z=#X--(-fK -я #bJB2FbDBoC @ ZB)p!(fР!pm ` `#SJSKTIYC#QH#*(-c  _( #2 CB .Ф(D+@-<h+!,5 32C .=#X-'$,%- \\B3B2#]U7x "pap#p .!H-KN%-8h( H. -&sM+ HHF dffe(0f\8fm۶(0fee0F -( $x.+<#xb;+JV( F0%mB窚d0F%%`hG F00F%%`hG F0FhGFF0H v( ,H`$B*HY(h'H)h.%(F#HGXC4ChB KhB #C@H*. -U0`hF+ eFG.0h-D0`:h@;`kڴddede9L`d0: +pGa;+W8A;78+ @Bpxhx($ p @Bx+2S+ %x+X0`%mB(208$ (ّ2=CZmru{;3`#;`($;`$$($;`$3$'3hBN(C$$B%;3`#%;3`%#;`t($$3$;%3`#;`_(ډ$$3$#%3`;%;3`#%;3`# %(jU$3$7%]p -B&((-8B( p pkF(ULUMc]+ #cU&7kF(XkFy6--Ш(@2 E-FJ7X3P/ ="X3P@H(:>H(5Ѐ#-4т'Q:K:M&PYB,8H(#Ѕ#\+-4J#\\S@++ /J%X3P.  @B1(H-% kFd(kFyU6 HZ(#X3\ B)'0KZ C B \3@ BK\F f*$(f)f$f*f +f pL#`#%P"3RkKlOTChQ#PiKjNP3PiK(P3PgKPU-9eKPeHB ").f#XC#P;\ +.0"Y+КXJUT VH3[+a;+SK+W;x3x*ЕBIKPCJ#TIK"T3"Pl>.܅"#TDH-]#\ +.0"X3P#X+4KX-#XBH?/х#" &7Tс#\+-IbXScPx*x *! %x*- 0* ZxA=- 2x*3 xZ+0;6 .;+~ 3B~AC%YC @B`h &'%F f*+$4,e _e #NK\+&т#X+!/+K3MK\+І#X+ЀKX-;#XB #[B`#"RBPГpKsJX)oH\*TpH"\\Bs%mLRUTBMkJX*(bKhJX*V_K`J\+]M#X,ݼB<`N"Y2"X?PYQUJ XXD$x,8x(;x+ т%CLcY+8x()еEJ XXD$x,8x(;cQ% \YXaYQBP=--BC ;+H%C.7 &KX+!J#T(#\ +.0{"X3PN pJ#T,cKJ\+["`! KIBP)$dBM#\ +.0M"X3PF f)+, *4pG (#LKX;+ % "      K"TG(H-tF f)I20KXpGeXsdKMOz<+}BbhB4ci0G(ch3r 4{B$FgH-$0hz+|i+QaH-$0hz+#%0h:)l*b+bBT"915-+`T"81L0hz+-Ы@k:)<)AH-i+->H-]$X +Bi9I@KA8KI@\A6K@\A4K@\A$!I%BeA*a90h\%+,7I "8,(9%H-Py$H-LG1hKLi#@ZAJ["@VAJ"@VAJ"@VA"RB@A,a&Red3edddedd d3dtdRd̪ddh$+ &$9 1,(( 4hBh:!0G($dB $#[B𵇰 ))#!(,#(,I"cT:(c8h0  H-0 :)8*H-Veue7#h Jb+ JC+ J J+7+J Jt+chIa3-P7F2eeee eeF 'hkh+ h B ١BYh2ha(GF& @BF hk{h+0h B aBYh~ha(GF& @BF hk;h+0h B aBYh>ha(GF& @BpF((,$ !0(!J !kh-,II((rT" 1(4, !@FpFBeHe#[\U+/K\++2#2&x0@1B 5y2OA[-+ I"60,( IR0",((CA@B FneneJCi[ [jF 3F%#mDC+"!l( @BF((cn+ѹ33X*ffXfF𵅰j`:`{`si"3C&3iFFkDC`{h2BQH- @BFhh"0)(JHhqh-h#[\FK\U)Ѫ*DHhh3030F*xR9*y*6йjxhB2h)!@).*,Ѐ#`k*Chyh#`뉪C" 2c`04 ,I,0,+y;ZBSA*x[*:CdP4+y#p h**y*!@)*zh2z`5E!y@(*3BѸh(x##`2ib`" I`d,0,[C:hh*;``Ieee3e"#0𵏰aCi`3"C&3 iFiF#[aBSH-GF 7$lDCi#")Z(лiKHYh*-3 (GKGH\;\-#[Xc&6446hBChBj,(5-@FpF(sd0F s( ( ( (KFXm! F00KFFXm o(` ` F00KFFXm( Ynh8\n1iB F0AhIhB(KFF[n+L# `C(D! @1k) (- `"2#``3JF#acaf`RnhK`!aba`j+ G3k+ h##`ci"iS``##aca (F %mB%<`#%mB`% %hpGF$ A4,т< Fh29*((h*BF# `w(h2B,;#`Fh#`jj2B,;` pG0F -%` F0(>(0FChZlhKFn*n(h4,;,2jB0 F0 @BlB ,;p#F `K @B@Fp(h2,;,1jBЙlB+`3,;p#F `B @B@Fp(h2,;,1jBlB+`3,;0F) (,` F0F#`"FF#`"FF !4FFh!"F0#F ` (#h+] F00F (#h+8 F00F(#h+= F0JFFSmSn h;Qni3BF#0;0Fjh,1`3bc`i+j[hi+ F0G(#kjS``#b#cKFj[hhАGFkj J``bcpG0Fj[hi+ѣi F0G(j[hj G0Fi+#j[h[i Gj[h[j+ИG( F0KFj[hiАGFKF(h2,;j,3BF 0,; 0F(VClS[Qhi+F! NC v>cl ') cl C! cl #! | Zѣi+#lkS``c dcl`h G( F0%mBFDk%h<<<='2#42<3B8F+#hB (/Hah+/k,<;Fߺd0Fhj+D6! #j[h[k+ J(! i+hRk*j[hk+ I! clJ@cd F0F(_ClZ !j3,/heLeKF IFn'CBXAF0FH -(") F0F e0FH#B! F0 eFI I( % JX .*n(5-&0FFZecedF i+k`i+`/6jh#h{AhB.тB+h+ F+hji+"#jBҢj*.j*#09.+h+'#jCCjihB @Bici).)ai/0.(iA h+# `#"TpGA h BHhpGF h !4Y+#+`F X,њ4`Q`"T0@(\8KFHF`fJ#\(!TpGF`fFHkO18B3h, Mk#1(*F$dB18 F$F`fd03Fh+4#h 3#` F0G(0F K)Hd-ШB ( F0Bk0($dB,`fpF n&, .C0(0@Fp#+x/+(#3h+ Сk()(#3h+Yh+"2hBСk()(.&k0+)H* @BF@dKF2h;`+ "K I H*H*3h+ИGF[ddd&dKFFFhhhhB єBNiAiBїBCh["RB7Caa/41#8 pFmG @B F#`BFۂhh9(B@ѕB=A+B6+ F!n)*; G(l+ckBu @Bn+ "0.* ; G` HFF#`B?ۂhh9B9ѐB6A+ѕB0an)ch[-(F#o+#ch[ ( "0. ; G`; G @B F #3a`_n)!n)i+_% : G(l+ckBu%mB(Fi33sh: GF #+a`Ch[%3(!o)an)i+ _ :3 GFi+3kh:3 G @B F3h F+".#ۊhhdF5BєBABѐB:C3bFGF_#[B#0FCi+ Ѳ"GKGIHH2*GH)%+EH*!= B_c#3`3`[`ckBlcc!i)KBQ  ")2 22ћ2! @YBKAQciab+ZB1 #(333ђ3 @PBBA;"@:@b"cch"9@bB  F0!#hh "#:(_0СkH*Qddd&d`fpd0F+hB шhB 0h G F0 @B01F h)+hB фhB DhdՈG F0_ @B  0MF(o(L(! F0 eR eF2=! )8,,! )15B( )5"R2/*{B))  :!)U(Ft.%mBKFF[hM](aOJ;hM+]8h(h )8`0)(`%p e-.){I " )( 3x+;!)E(()-:!)B(\kH*WjH*T Ы'eL"!(0aL(!(+h+(9hx+ )b()h0)\( F;3hB86( KHk* %mB"pk08q(v%Dg/?H"0)#3U08KB" 0( 0KB0H1*]#3hB  (Сk'H* Gd ( ( *  ~ -#3hB (Hk*k0=%Fdhflfdf e e edfc ea e e e e, e0F04$hhmG F0F0h  oGF00FhoG F0IF0hoGF00FhDoG F00F1 hMh0 h kAAnG F00F1 hMh0 h kAnG F0FhhBіBٻi+zh#kABѲB 31h hKhkAoGF @B0Fh  1oGF0Fh1 hGFF5hh.hoh0{A``h mG( Цiis{*hkhAaa.hohhhA``F01F0 hMhhkA1 hG F001F0 hMhhkA1 hG F001F0 hMhhkA1 hG F0KF0h3hGF0F0h1 hMh1kA hG F00F0h1 hMh1kA hG F001FhIhKA!1h1 hG(Ѹ4#h3#` F0F5(h3h3h#3h[h  {AnG+hJ2 Ѵ43"hh#`F43"hhFh hB B @BFi* nh'vWABцBi*#3h3h[h_An2;G(u3BѰ4#h3#`*h*'jj*.Cj*.76kihwCBٯiai+.`(ai+.R(pJ3Џ4F h "! .x-+("RB0``"RB"acax@+0"*) aaa3x(+Z6)!0)P(6H)"* ``р!IB/H) @B6]++H0*I")(Ѣi#Ca3x,)"Ѣh2hH23(*.j1(}= (p'``F%&;))H) iai Jhh)8)W F}eOee`eeedF ($ F(!F0(2)-F!  '!h,ѩkH)I0b _ $dB F+x#pikhCc`hh``kicaiaia+j#b+3h#3`+3ch#3`+n+АK#fkn+ЏKcfn+ЍKfm+ЌKen+ЊKf+o+ЉK#g+o+ЇJ#go+ЅKg+3o+#J3g+3h+#~J3`o+|Kgko+{Kcg+3h+#xJ3`+3h+#tJ3`+3h+#qJ3`+3h+#mJ3`+3h+#jJ3`+3h+#fJ3`+3h+#cJ3`bKe#3`!i1[i& `I`96 `I`QYb^Y\2`s` kj+6j@)P jj*7-<+i0CC3`#s`hh0hqhCѪhhA``hhB~тBz"#2`s```8Hh)<)i+- 'h)i+-9 'W2`s`hh3h3sh32`s`hhABBٽA``̦daaaaiaaaKa;aca7amaiaىa a9aaaNJaadhh6OABBA``dKk h)+m+ܡ#3h[hhhnmYA#"ZCWhFE}hBy+{"ZC&iBWhBshBo.GKHIHHIJ)xch[+#3 bj*fj@(ch@JAH@c`h)`ch[ՠhh bj*Zj@(ch5J6H@c`h)Iklcdldldkkcc+3h&'+hBhB#3h[h({A("2h3`#i#  _A3Br;hB'a32}+i#a!i+- '4!i+- ')9dlddddd0h;2hB pG3h+  F "! -h # x+;+#X~((#"#B$hx;*3`` ` ^( 3,H) @BF!I(ѣh3 h3ѪhhA``hhii{A /)ѱBHii)V /0- )#i3ci3"acahhYAkla 43 'gF e8 eF%B 9FkX250Fhh;<#&6BF#3hB  Hk*)3h;sh2hS``#3`s`k ۸dF%"#B iy0ZKBF22Qh3S``Y` `#3h[hhh5KAF3Fh+ 3h( Fl5I (1I ( ', "!-O (D! C<+9!I (I I E(I >("C#kl "#(KB*2Qh3S``Y` `; Ped/,edd_e3h+ИhhpGhh#BKh+КkQARB@pGfF (!KPKI0)(chh I C h ` Kh2 F` @BfxfetfeKhpGFtfK0Fh* L%"` K ``() (! F0pff|fF)x2n" h:@Mi$@F".E6K6I7H7J)u7H(,0K0I1H3J$dF@dF#Bn@B'м%K&I&H*JB"K"I#H'Jh*KIH$J*hBKIH JZKIHJ2UoՁ00Ahh*-CC+Ѐ#@BKIHJhh*FFdked &d%Fh33 rZohh-&#'#3nai iKC#_AB FoBm_o33:hYh-:sC- +h"@"B "3K3I4HR)3H(i  (u3J3-Ѩh ji)j(s('ci  KA3B#3Zo#@  _A3 @B(ڄ JX"@R @\CT"2h3`dked&d<F !h" @"@:i*ZC# @Beim3n-y# +F$3[o@B-#d_A 2;(J3u3u#[B +B  # %gA+x A@B" Y# @[ I[XFcDcFY\+КB "@ Cp2h3` 3 (5* 2 @C  2p"<Fh#@B>3Zohh-?jh -*1B#3Zo3hYh-(6?"2osB #33RohYh-X (F&'Fii# +3>h6# ro@B;33hYh,@@3 co$c cC SC;5hh,# X h37Ii8 F"$0B H( @B" eF}Yi\%@m)A%)B nAoI@ )IY B 2[#3@ Cp X(T,SSSS!#"<4Kpn pp,#3@#Bdo "!,&EBA3@#@*@8(BЛ;3n"@iSC!{i#KA8(}Byn2,f !@  A,i+sCh  3\.hFfDTF !# Bږ@"!*,8,-;3[o"@.**/O(."h["'i"%(8)#r FcDcD(  P 3 ;B :F " #! !#"!#9#2@|i aARdBB[i @"! ,_Zij,d@#@i!ZC,M%h ZijM}Y(\ @ RA*A @ReF(\@(@3@\CTE y</eF#X4KX4KX+\/Z4bo#@niAHC!&(L;h#@B$o,N:|3t#.@B 3:(! F#[B0|2t:h@B3h;2(.$dB $D<F h3Zo o33hYh,#B Fhh,{#:h36K!@B2XC'44nco!A.KXF\ @RA%@+CbFSU@) i+bo, 0*FcDi"FiB cF+i+383Zo IuX$\@d "A"@CT"@-:F0 <F"Fh `F@BIi;2 FiQa`+ciaB S`a ;2Y(u3J0cii#_A3F_onh 2#@"B hh:,C#[B#6+3o+33hYh:,8@'B F#t"RB:`+3ZoiB$^C0, ii(P"#hhiBbi!j'h(& @>`"h+3Zo3hYh,773hbi!jhRji\t3F6n #@B!X)ѼIRջJPKcP%cY+*р! $ &( #[B FJPKPKPnK@#[`X`sn3CaKb#C``Q#X #MroXhhcY2,C ! &uKP(+Ѧ#X## [B (ьH(M`Y#cQ ' #ro#@niAHC!&@(єhhnXh, ai ghhRbi\t+ hXh#3n, ai ChhRbi\t#X";hfY #3o # .3 % B ~+ wV# \+ T#[B:h3B{[h.^qIh31t## J3Е"RBZ`Z#=tD1{q| |B р#[@Bt#["+#Bs|*| B+trt3h;2 (3/5iFD`'"/;`'BFH'/` B BAH'#+`B.N+h ?'8Fu3.`0H'mB  u3 #H'Q+h+` " zA+"iVRB@@ #"i(RB@ H#'##i#  KAF7e^eeee 6M \?&,]'7@FfFw@@&4B$b@\@C#$0dBY@&P< @1@'CCC%(@C< @ =C(@<C @C @CF @CC`FC8p@ '8@0C?>@C?8@[+@0CR"@C C CCYp"C@C pi exx^xD@PxxxF@'S@7CC!F58@hw@9U'@U/9aFIa@@U/3W_@T!@B-#'C@&c3@49@3C&;C4@C>+3@#C>'4@C=@#%C@(CT4@=@@,C"C@\S@T $C4C#",+J @B!@dKF!3jIBGF0hxpG0hpG0hpGFkFq23j"GFFkFـ23j"GF0h#B\3p0h#B xT30hR#B\ [300hR#B0 ]HS3F5m'OY##[X+#[Z["!X+#[X3p+m"F!3 fFG(mY GFF#FX6KX5KX\3X3KX#X#G/$#!2XB$KX#FdD%+(F#X*!G?uXY,]U7K"XKG(ڴ2h3`;FcD2h`BF#FXKX\3XKXKX.#!2XBKX#9GF#X*!G>|X]X6%TF KFK "PFF 6#k[B!(G'!xi(4GB3l)(G"@B#[BFF 6#k[B!(G'si(G p4B F30n*2fk*BJcl*@Jdj*?Jbm*=JeZm*B : #3!ZnI BКk*%n&d#3#[X@B%53! IBjGj Gii# #3!jIB Gh;a-#3h BJ%mB#3h %Bu= (Fzh+^#j%5o*Oj Gn*E#[X@ci;@ii SA# #3h ciB#[XB#Bf+cѦ#X# 2* #[XB #5i#3Xn!I @B+BC  +#!K"[j!@ B>;h+^#X ! Gۡ +3#"[RBP-KX; @B* " BЦ#X" #  $4 "#3!jIB G{h`+h ;a- + BH#3[nC+@ qK X!3 G B +\#3[n:#"[BRP#X# 2*4+C B+::   /#S B +#3[n+#3hB;h+#[P3P#X# 2*##3Zn՚k*"n%#3hB3#XB#3m+M GB` =#+ +*3#[X@B &36!IB jGj G# t#X+ #3m+! G%mB_%M&%%mB$F*ciijB&6k# [B! G-*[j9 G F @BF+-iB&6 kP! G+sj) G F @BKFi#X"FF+-iciB&6 k! G-3j) G F @B#F[B5!kG+l! G"@B#[BFF0K]j#@ 3[n -+%'KX !0G2#X+*CiB-=" (&+-K-+  #X:!0G(K [j[ F%F F+%.#ici[B%5 !kG1+j G#[B! kG+l! G"@B##[BFFi#XbiFF*ciijB&6k# [B! G-*j9 G F @BF*.6k #[B!(GB Fsi(G p4 @B#F6[B kp!G-si G(p F3FZn#R kF!#VCFFkhh +h+ji i #`/#[X; @ @C'7cio*wj G (n:*f#[X@#[ X:*BBjh#{ABтB#"[RBP +ki+Ј  sA?@ci/ЀB}#3[n !PKX;B#!&[IBP#Y11*#Y *Y" +Y B+2 f  +h&;ZBSA6 l:FgF! G;6 FcD 3 #[X @ B !3 IBjGj GihBp'%B#iX!*:kh`+h+a#3!jIB G8F'B'B45Fn+ok@" RB`!G#[B! kG+l! G(#@ @BFKF2onAF"0RBF3k!G F0F*)6+ si(G p4B FsjG @BF  %! 5(%U&v@'%NB#3k+G(#1 (F#) (+x;By[KIHJ&yF@ded9KFX 3X6KX#X#X #i 5.FcD %JXB/#: S+=B#* E FcD(0 F!Zi#B ( [3##FX)K X#X'KX.ܘ#Xii#BB) F#9 "X* ) ѝ"X#)  JX*) KX>F FBi# ( .И!iaX FF&v@%#3k+" G(*KX"`K!P02*Q # ` F#9 \(;x+B >%I.F %@' %( kF#1(4(3x;BFF 7") CiBOP!"{k G"{k) G"s {n-Bؐ-Dх"{k1 G"&6sk1 G" skGsn[" skG!{k"IB G-+ ؀-$#*C`*-#3k*0n%!.>>1+;+v@#*C*-Fk+8n%{k "p!G! {k"IBG T % AF P)Ci$/7{k"!(Gs"3,.6!sk"IB(G,pC,xk+Ѐ0n%^4{n,#ؐ,%{k"1(G{k1"(G3"{k(G"({kG{n["({kG#;+v*K<@F,лؐ, ,`,,,Яp,Ь,,Чk+)0n%sk("p!G!(sk"IBG(sk("!G!sk"IB(Gsk("0!G!sk"IB(Gz %(F!F*)6+ !xi(4GB F3jG @B FDJ#XBJXX"XCi=J X"X:BSC# (P B-I A( "[iB0#[B> ..B#2 FcD(!03.## n( " Q( F#* V(F#FX)K X#X'KX.ܘ#Xii#BB) )F#9 "X* ) ѝ"X#)  JX*) KX>F#FX/KX.K X;X.ј#XiiB3B) F"K!X8G# ѝ"X* ) ѝ#X#X*8G#)  JX*) KXFcD>#FX#X>KX=KX>x6+`3x`#8=(,x+hB#[B#2xhB"\+B::2S`*hN %)AC h+ГB8 "P,фL=5kn"@Ckf#h+ᢋ* #((4v\F6\E 3+*S#!X(1Bѵ0h{aci;aa;3x"3RT:#i22 Q``iknCkf#"[R3bR3bjPk+#hc<4bn#@G+PKQIQHRJ$\cn8Ccf{i!"RB4anK!PB2&;33>fh\h2(!(#[8P;i+ ")2 22)"@JBQA[;-I* $*-4*-4*-4ѭ4"@jBUAd<:2ggSg,Qn# CSf#[!PKSd#BKkBKc#X+Лh+[h+8GFFehehded(aaacyhB#["P#hBhBT#@!8(LI"#Eѭ#;;k#[B@"!8G"#8(/ѭ#KFKDx K@!XMC+@M9[C@ )2Eѭ"JxJxCB;6.ѶH$M#h+Vk*ѻc#i:22 Q``h+#X*h+h+;3x!3I{Th8hG:2Sni CSfKy y!CIRԛ# #{P# !#! k+ѼcJ#xxCKxCJxC#zaxKx CIy x CKx CЀ @ !B9 @B9 @B9 BӅC;@#:axkKx Ca#xgKx CeIy x CdKx CЀ!I B8!IB8!IB8!BKҙC[&;4@#x#(=55 (HK(`i`x#[T3X+ CKZ3B:2Qn# CSf?KZx*3x!%@-@@ 1!@C('![ a! @9 @#CUa+؀!@a!I@! !!!!+#a F0!I#[\+0n#Cf pGpFkF "!X'#35p"m!3 G@Fp#[X+Ж#xKxC K{#P J3eBi#B0n#Cf pGYZOaAi#2BQn;; CSf!IA\n)Ѐ!I C fpG! F6sh+_ѓ33\+Z3x+U3x")#@@Ca/ #@;@C8(-'"2"%'*#am #@;@#=C@#a3x!["[IR +؀`R99@RF#[### H###`R++#R(#<# Fu$e#[\+0n#Cf pG0F 0Ch+##[\)#3x"@%2m2+ x+ci[[ a#bS[" bS++ ї33R F0#["RH#(#cSF5qeF *L+Jظ"SC%I('C#[X+:!J"Kxx JC1#'"KaaxxJC1#'qJK``xxJC1#'bK(bibx##xC"SC+a F @BXnd:9@B;>=?HpGXndK #BR  0hppG#KF H) KJm# CeF!f؁d3"ZfJ!PJZc("fJ bpGFiaaF 3B3B3Bj3bn!!(!` 3G```*"hS`bDb#` F K I H"#C H"~bhc`bBb` @BFddd&dFh (FKyKz zzC b~C#~C~zC~?C#8FcbFC?CCC :C' ?9@ C @C*hB%J%H1j#"J1j#H# (z @BFh9 QBQA1BJHFbF CF9@bFC @C*iB J H C9@ C@Ci BJHFdHeeneeeFih 8 ="2 3B(`ih 8 ="2 3B,`hh 8 =" 3B1hh 8 =" 2 3B5%h-@n FCjjS``#bCbt+j( ;CjjS``#bCbf+j( ;CjjS``#bCbX+j( ;CjjS``#bCbJ+j( ;+h-]h-h! ?CB٩h"BѪ`j.8+j`3h.^h.h! 8CBٱh"BѲ`r`F")2x(3xC#*3xC"+2x-(!C-12 xx C".2x-C C!F@/1 x+C%- (@ CC C`F @Ci i)@ CB BjJkH1j#%mBzByBty%+k#b}#}C}C}C C@C" @ C RISKXqX0(J3ЈcC4CC"C@C# @=K C X@B9BS$BB$'%+2KX=m=C%C( F;|%)K!X !B>$KXB9{h+"0=B(JH1j#B'BK=X _'\$BB$kA=C'+ %0FdSe eF  bz#zCzzCC C&6@ C2@Cb{#{C{FC{CC`F@ C1@ C"#)2x(3xC#*3x!C"+2x-1C2 xx C".2x(CeF C+@!C/1 x 5@C+C C`F @ C1@ C# h.^10 !h`F`b`b~#~C~~C&CC6 3@ C@C+ac"CCC  C2@C  @ Cayacy;ZA3`kBc +b#kbb( 0`9k3cKB(F5 =+hB2 B33 %mB{mB;mB;e{e+,3 # 3h+V *!(n!_ `B```|"C@Cty @@|C CtaajhBi`a}"} C}} C$!$ C$C$"@C @ Cjah2` b 0"Zbb 0` >hBB6iBiBC DJjDH"A!0 Z @BQ #1? (G#BY *!(;; 3#@3h8hhqh() 2`r`` `"@ CYA1|0C C3ty@C@ C3taakhBb}#}C}}C   C!C  @C" @Cka ;3#@ 8L FJd^qeh( :hBpGBڀh@hF7,78 0! 00k;cF9(i"2a*`k``F h 2B ZhhJ` <`"`Z` FLi#h < ;:#2 3B8J8Hj$"WdB#h3ѻm#`ch&h2K6B 0J0H j"Aj-K!X  30! C3 @C3 &63@CFC@ aF @CC +rjr r3 .sks3 6r"ssw((*(.#h"j3#`cjS``&bfb} d~edDe !F p m %mB(FC`` 3`a 3Caa $3ab`0 cfB8K!X  BK`(K!X  6K( ` %mBKh8JX`(мKXBA1jH"n) {n8n+Ѝ&eK:kX!j&)5{j+рJ1jH"[H"X|h <# 3BjH"M{jBiJH1j"D0k#(;k3;c3L"h0ڈ( &'&j"3b RB#8-nj"3b RB#JH1j+"W%#hy){J}H#1j"JZzzz CCzFC Z{{ C{ C{ CbFC"@F C   C bF@ $C$ "@C @C*р"B WJYHZK1j"IKh%Y~~ C~~ CC C@C" @ C#X*P*XB# WH1j"" # LJRH# pahOH"$jzkjB*#;dIH1j"8 8,0(  ;h2Ѻm`=J>Hq h ; 2jB/{h ; 2jB.{i ; 2jB-0K\8(# <;l+T'J'H1j"$J#h1j%H"~h2Ѻm` h2Ѻm` h2Ѻm` f edrere`see seAdsete eteteGduuedue dueze%h-ch+ۣh+ h(#i+ۢi*ci+JH)K9BJHkBJH8(JH#X[[BݾJHt ,0( =jh3*)h)ڳJH1j"{lBگJH1j"1jJHh"!( j%lBݣJHKXB۠IH h#i*hBۙJH+ЗJHhchBݓJH(ѣhBЎJ1jH"-ъhchBхJHkBЃJH8ћ ;,0M ; L "hIh#0 ( qJH1j+"`-ܼ%"hSy;YA3hBgJkH1j"LdJh1jvH"EqKh^ i )1i xF(3x C*3x C+1Hx x1 x$ C.0x%C/1 x$ C C! C @#C$$- %@$ C+C$ @C @ CBќE cF6J1jJH"PzzCz Cz (C% C- )@C!$ h @ CB%J;H1j"{yiB J6HP{{C{ C{ (C% C- )@C!$ h @ CBJ(HP~~C~ C~ (C% C- )@C!$ i @ CB6JH碛dve~@ve]veveveveye weh :werwewewewe&xeIxefxezexexexe ye*yeQ C$ C! CC"$$"@C" i@CBКJHbb( +YJh[hH{ {C{{C-(-,C%C-*@"C$ $ @CBЂJH2H} }C}} CC C*@ C[i @CBtJwHwK!X  s#2rKXB8# 8,0( ;[h"T0 ("T3(h! ; 2Bg{h! ; 2Bd{i! ; 2Bai! ; 2B^#IKXB\ +@Kh(BKXAKh#:kP;K9X0;JP;KzjP#lPm3P90D 900i0#XZhTj ;ZhTj ;ZhTj ;ZhTj ;c]++JH1j!#5ur %mByh+j=1(t <oFdLyefnyeyeh ft x ye&F%YB܀F#43X) 50F iF )  F0FiF%'.YB(F#43X) 56KX(Ў"X3PpGFf"X;PpGF'YY4BڀF#k63h kOFtF#B%/7JH$X) XkkBJH j!H&4 ,x+ JHk j!8&vB3#X+3 +ѵJH j!!&+ܛX+ЮJ jH!!H ѭKPb&#"RB6QP,32PHk!KXm*СJH!j!&vBY*۝IibPhh Zj*l)%KMP;`Yhh `K`3h+7АJ#\ CT aY Jj*V%K3@ՈJ;C3{C  {C9(%&9%YB5#PhKX;x+rJ;\ CTrK}iP;3hzi@oKP-kBcJlH+!j!ni-%z i+%ni#PB.s3@)0% CTJ^B?33@P RJP"XQI* @PKPbP AJNH3!j!(H.KX#( !%"PB6K"PZ#P{h[k1H!j!.K"PK!Xt,KP(y! S J&Hk!j!"KX"KX Zf $dZzezeze{e 5{eJdM{el h  {e {e {e(|e c|e |e #X3S 3_hkKX+HѬ3F%`FXCcY!3xCp#X)aYbF % uzJzH!j!G l #XX.oYlJnHk;kH!jd3!$#$3hI"j'!##`YB `KP`KB._K_J_H!j!  #43X) UJ!j3TH! !j2PH!6MHZhh Ckk!j!FK!X aXDH!j!CKCJX#XX!j@H!@K"X?KXX!j=H!=K=JX#XX!j:H!"kY:!j#7H!#X#["#XX!j/H!#X"#!jXX)H!s)K"P g&KP)* 04F &r &" vd|e}eF}e{}eD L $d}e(d}e}e ~el =~e u~e ~ex t ~e#eieeH fpF( @BGuЎ"X;P+ .>#J H!j$3!JN%P!* 7Y!jkH!   Z#XYbKXKXY Hk!j!(@Fp Fdef e e9OF;h + 6H !!$dB F G0K`(V$-N;hB"0! x(ўB0$KB*"H1!uB%zKh#!H;`!eDlrl1lL6(kH!T(3JX+j!'4 $dB feffÈe eef0F$ JX+j!4 ,$Kh2K"` F0ff fKF !!B" @BFF OM)h )NH! @BF@! [@(2!GH!(р!8> ] +#U'?I 7P/:H+E+hL#ZC7O th,( !+B.JB .H!!L#ZC"RBZdxK++ЀG+рL#ZCXd(۴h, !H2 q(H!M+Xdh,  !@2 \( HL"QC K"[RBd+h3+` iF fee4eef:ebee#FX' 3]h&Y"Y)(Y"Y) FF# #XB #4#X;B mbx#xCxCxC C@C" @ Cby#yCyyC-bzC#zCzzC?Cc{#{{{ C!"@B"#2x3xC#3xC"2xC  C!  @C  #@CBsMsJ(1j! j F+ jI" ~(и43i+) C+@C#- @:;C;@ C; @C)C CC՗#XBړ)ѐQKX);BЊ% BIJKH1j!B#EJ1jHH!: g;+s+rBKXB:J?H1j!$ # C-- -^#|+] i0 B #%3#;3#XB4{{{C C{ C*! C B)1 #(JH1j 9( @B:75####}#{#y #w #uFedf eet IeeF^K! X-(ѬXJX,ѥ+#9RKB NJX (F#cq##wcwww#vcvvv#ucuuu#scss""r!:brrIB2qsr8mym"#YA :e{eC%-*@C!  @CFC *@C aF @C!(1 pHp p"p,2 pQp ppqh"#XKXrhp 3hrh9@0wk;+zi3 3S`2b:2rb{a] %mBiF F*A ")@B! C @C" @C*2 pQp pp"'VCY)$ jK\Y ( M!j* H I H J+ H M(F de8(8X.9j H U %ffV 7deՏe et x edee1deRd-ejx+xCxxCC C&@ 6C1@ C! @;Qjx+xCxxCC C@ 1@C Ccjy+yCyyCC C@ 1@C Cejz+zCzCzC C@ 1@C Ce&i{6"@rz C Crr*{:QA2"d{{@C @ C !"f yX )cd1d0$h#n"d3pcbxsz2Csrx'Օ"XY gJhH9j  0$#X*>dB46%#XB0h#5P;43P;k3;ck#l'b+bldd$f eaeFcD533RЀh(3iB4bz#Ccrbld8$> "eceqi  KA"ecesidkB/JB%#XB$c*J9j*H );43X.(!5k+("h9jH y(BhB݂hBh2lBiBۂimB#1jJ jH ^ 0B#### $9Fd`e1dfeeÛde03FhO L F0KF\'GՖ#XBBڅI:B݄J#{C#X 2Y\XxCxx UhC C-& C@ C!  @CёoM!j*oH nH!j;* #X9 Fk+ ۩m)m+.n.\N_H!j2 ##XB)UNXHXKX);BPNUH$3BKNRH!j2 !j;2GH (+l;+@NGH+3 [z "@B:NCHCKXB6NAHjlB1N#Caa#`9Xў# h.%`f`` `%4ki 3kaK B(FhB335B32i3B3 %mBFFKjKX+7hh+ !IB`2(T2(l F$dB FKjo3hX+(E!#@8Fl+p+TJK!X (|GKX.w#2(}'((KX* $dB:KX0F('PJ$sCC2C C@C" @ C#KX0#KX(r("J3l+J$dB'+H)j+ /(# $+' @BBF eF KjKX+v  3hX +KX ( 3TёK\PJBݖ#X I[ 3[h K!X (KX,# ((KX k  )j{HF #"(~((#(nKX HeKX+ѫz#2hsh !YA0`q`C#@C  @ C6 1C6@1C @ C!(1 pHp p#p,3 pYp pp"(QFcDFK!X#+3ANY #5KYX(,/5KX  3hP# (q/H)j(8F&IK XiX((V#(L ; +P)jH~" #[B+ J#POK!X ( KX,(F 'BF  e +eSe#cq#2hsh !YA0`q`C  @1C&6F2@ CcF CF@cFC 3@ C!(1 p F!fF)1p F!*1KpfF#p,3 pYp pp& C@C6 2@C #rbr rr C@C 2@C #sbs ssVKB'qm C@ C!  @C #wbw w#w(+ GK7X ("(D + 3hP(y7KX 5KX (2({.K"\B,JX+3P#3(1;+М#2hsh !YA0`q`&6C'0@? C:@ CC1@C 9@C#(3 pXp p qYq pqqH)j-o' eeF KjKX+Ї;BKXZR[B@K!X (rKX,l0жKX #:h{h !YA8`y`'?C 9@C! F @CcFCF:@cFC @C"(2p F"aF)2p F"*2aFp#+3p p Xpp"/2pC:@C!  @C #rbr rrC:@C @C #sbs ss{KB%qm% C-9@ C*@C #wbw   ww@BR#cq  C 9@ C )@ C #uau uu  C 9@ C )@ C #vav vC;@ C*@Ccv ww w#w#0GK=X "0( F"0=K X:0V 3hP0k2K"\B*JX+3P#;0;+М#*hkh !YA(`i`%-C'(@? C:@ CC)@C 9@C#(3 pXp p qYq pqq H1ju%mB %  eeF KjKX+w+0 FK!X (\KXE-V06#:h{h !YA8`y`'?C 9@C! F @CcFCF:@cFC @C*(2p F*aF)2p F**2aFp++3p p Xpp*/2pC:@C!  @C +rjr rrC:@C @C +sjs ssqKB4qm$ C$9@ C"@C +wjw   ww@B  C 9@ C !@ C +uiu uu hqqC;@ C"@Ckw w w+w#0-*0 (EK X:02hh`+00,3KX(ac1K"\B*JX+3P#;0;+М#"hch !YA `a`$$C' @? C:@ CC!@C 9@C+(3 pXp p qYq pqq H1js$dB $  eeFbzzCzzC&CC6 3@  C@Ccy+b}#}C}C}C3@:CCK X@ CZ[B@JBݖ#X I[ 3[h' +b{#{C{7C{C C@C" @ C( _(Х ? 3hXBГIKiXX((7(Єcy+~K2X(zK X2@B2..#q31 C! 3 @ C3 @C cu u"uu;C @C @Cbw w w"w#:h{h !YA8`y`C '#?8@F@C CC9@C cF@C#(3 pXp p qYq pqq"(b&C' (8 Fc"CCC2@;CC" X@ C#"( ('M('. 3hPIKXiX((CѯL(Y!"LK)YX(('( K X2@BPB'B  #%FP; mKm !KA2`s`#X3B*ۑ%cY+{RM"QH!j*PKX+OH!j* %mB44&Bo#h+3h#h"3`64#43X.3k!~22`(f#kB.ܖ#XB3J8(,0( =hkB+ 3ia:2*bkb`h%mB3EP22hihP";cQX3PK\%(F [#bYXB!cP9bP9bXcP %mFܛdex e FJz zCzzC?J{C {C{{C6J|C |C| |C b}C#}C}C}C#y+6J6H#)j42J)j3H/ p F C F  @`FF!C `F@C (XFBaF J"HF`FCF @`FC J @XCBIH ;: C;@C; @C32C2@6 C@C/р#8BJ)jHF՞d-e(ee ee!KF\ FkxxxxC$C  #  C!"C $ @!  @I#CCB JH1j( @B)(J1j;H~F #IBUd$e$eFKyy Jz zCzzCJ{C {C{ C{Cyc} } C}f~ C}6 C!~C~ 1C~6Cf!6C 1C6Ca6C 1C&6C! iX )gJhH)jeJ)jfH / F1C&67@9C @9C9C7@ @CCC2@ :C@CC2@:C @ F:CaF9CF7@aFC @7CCCC8CH>N9B8J@C' ?9@1C JHB+JH=+JH8*AJH2F3deJeve~@ve:eveveWeweeeee!e'e$KF\ FkxxxxC$C  #  C!"C $ @!  @I#CCBJH1j J1j;H(  @B)u(J1j;H !IBUtdg%e$eKpF\$K2X!D IhXxJH)j# @Fp l _d8eKF\$ FJH)j3,$dBF 9d$eF-xCp(K2X!:YA# !I  hX/J3 u3'H)j2F$ FK:* J#H)j- B#J3$dB K K\l ԉeljeLdee 3KF!X V@#:#0v(J38 <"!@B!"=1 x<2x C">2x- CQx*  C(C*%-*@ C! @CBMH*1j*1j;H %mB (F"90 %mB d/%e$eKFXKX/ JH!j'B8FK\K2X! (JJ H!j3k/F qdse l eF@# )#(J3jx+xCxxCC C@C" @2J CB#J3$ F@"!((cA4/(T$ <")@B*+=2x<3xC+>3xC*?2xC C!  @C #@ CB/(#,)0l(JH1j$dB,$F#IBUdSeFIKXGKQXFKX/(J3jx+xCxxCC C@C" @5J CB#J3$ F@"!([(cA4/($ <")@Bl*+=2x<3xC+>3xC*?2xC C!  @C #@ CB/(c,)0( J H1j$3dB,$F !IBUXdSe9KF\ 5K!X(( 2J2H!j'8F:!{2KA&I`Xu3JH!j;*!(!JH!j:!jH!js2H#H "!'B l dde ee$eFeeFKX+йJH9j$dBRM18WEѱKXBگK\ԑJH9jb$K\18L&ѢK\բL! 8Y-KXE-';YK2X8( J2 ДKX(K F <")@B$*+=2x<3xC+>3xC*?2x$"$C  C$$#@C @CB}L"9j3{H"9j3yH(rK$X(c*18lKX(,iiK2X!NeMKA xYЋ]KX SK\ G(XJXH9jFRKbDXBn#18yg 2!KA xYCu3IB]]B4-ڀ%4J39j5H`"9j3H[c"9j1HU0N#! "0#Zc"9j*HB# "#!0H%mBM, 9j#JH"18 $F ,dse $e d׋e$el ddee׌eee0ebeU#Fp;Sp3p&;p";q#X'? C&69@ 2@ CC #tbt t/KtX C9@ 2@ CC #ubu u#uX  C9@ 2@ CC #vbv !vv<"@BC:@ 3@CC#<3 pZp pp"(!(( KX!3(0F&vBF +KpF\@U##p;cp3p(;p ;<"!#q@BG! C @C" @C#<3 pZp pp"1((!(3( K2X KaX K(X(@Fp @BF /KFX& B+J+H!j'B(6@"!!&KX$K(X:!^   b .JH!j+8Fx+ . JH!j+' KX)  K\J HF (dse l dd BdF wKX+ uJvH!j{=(*FrK\qM`Y: !  9+3#9 +K.ѷbH!j:L9 FР[K\NX:Y ГTKYX!(>SJTH!j;*( PI#`X5(KNKJ!j;0cY"9 %mB(CKX KA !9I`X(9KY\.KX ,K:X +YH7&KCYX #K:X +YL%KXY(J!j!H3+gH!j:9 5(+)-+J3 JHm-5F Xdse l e de ed YeeWee0%F- KXB F0Kh h S``# `K`"hGcY;cQF8 K0FXB%( F0Kh h S``" `J`#X;#P hGJ!j+H/8 ddK0FXX+J\JIEh hB2BhJHi!j @B F0BZhh J```X`F(  d eF"h3h+* Р#X+ѡ#X+i?+FhBۙh Yh0 F$h+`C```[ F0hhB2BiiB20)0i iB hhBډhBIhB KpF\ h (hJH#i)jd@Fp Dd$eK"F1g2 "X(;1P`(F KF i!PLF0F , F0!h,Lh, h"CB٢h#Bѣ`KXc`F( KFXB KX+KX+K\F ( O K J!j8YBF8 H !eL dF! V(K`a K`aEaZhX`B```"X 3P F @BQbb8 &NFY +,#KX+ #! Q ("ѠQ @BFKX+KX+KK" hh"RB #a K` K"YhX``A``X3P- I$ }fb8 Fh;i i Ki * KK9X%Mi h KXK\oՀ! c ((\kz*zzC6Cz*{Fk{0C{1CC{6CcFC#@0C&6 1@  C@ C 3@C CBјB A)(ٗN!j2H H2!j(%mB(K!X >ѷ 9i ~ *KA+#B {I{H ;i!j0  C!  @C!  @CjF}2rjF}rrjF}rjF}r 3srs ss9i2 i5`#X B*0da[K8"X3PWM"&cYZ33YhbYZ33B-S *#! cQEP06GKFH!j**2 *5K9X(>KX*"PChh>S``#`C`8K6.8?h %73K&A2@3B 9 ((FK9Xk&K!j\3B$H#X+ ё"X+H;PH (.+Б"X3P( Ƣd$ed!d.d  jdjd ddd!cX+ *Б "X2"P;cP#"X 3P JX;P)+,#X*&!jHM!t +dF ! `aEaa" F @BF?+$K!X (KX+KX+JKXX*+fJ#PKX%( F+UѻK( hh"RB ڱK""X3P*1 T)0 KP3P 1i#9(7(!(g3iJ+H!j#[B;i#[B3iJ!j+H}K( :ь*1 )0#RzzC%z-CzCC +@ @ CCR{{C{C{C+@ CC @ C:i1i pA8(< gK"XXB܂`JdH!j1:i3iF!j2zcFWJ\H+"#PRJPPJPWJPJKX+TK1X935- + ;iLH2i!j;KFMX cY+7K8,"#P5J1P3J PcQ/5K9X /9 z.KX*2P-ڻ%mB)K0JX3P"#PJPJPKX#[BKX; #HZ3a3 XP3`r``F $ , 6dee| Aee4 ( we  +  K0#[BK0# %F F;KXX9KXBг#XB4K"&P0F1K(X(): 9(, ) :9(C"K(Xa(K)2 q1K(XQ(K)2 a1(JX;P# )i  J H!j KX*2PF( , 4 | de F +H!j*KXX)KXBF'K0X?$K0X(3ѳ#XBK0X(K1 *)0K0! 1i ;J;H!j[KX*2P(F%e( , mde F KJX hhiBpKh h S``" `J`#X;#P hG(ЀFHiBhB 8 J#FPJPJPJP#lPKJP[`KI"jK!X |~KP(|K}J`[`3ByJ#PX:Pui+h = ;2+2 3B0h =2+ 2 3Bc0~ 8,0thK!h ?_(1{ha:h`^JXP;|"B]UK0YK!hDkha*h`QJXP# hh(JK9X> %mB @K XB;K X=8K X8=KX|]j2) 1(;"X;P.iF ld~ed l e$!B*N'N% x:C@+@X 1X@*A!B*/*+&@9LF%#DcFh?C@(@ X C@(@ X C@(@ X C@(@ X X@/ђ22* L% x1C@+@X X@Btd:*ۋ\+KX@B@pG 1AFMh+l$+"hl! 'B" $dB;Bl"#3:) J3$0 Fkl7lB$"0FX2X(ݑ%YY) B YQXP!\PHj8 F0Fke#"XXC@"PpG#B \B3 F%KX!8&2KAI`Xu2JH!j(F: H!j# "!HFl deYeeFaHbx#xxCxC&6C%-3@C *@CCTH!ySHcz"zzC Cz Cg{ {?C{ 8CC{ 1@? C*@ CC9 C91@? C/@:C>Hib|#||C|CC3@C *@CC4HRb}#}}C}CC3@C *@CC)H;b~#~~C~CC3@C *@CCH$"#=2x<3xC#>3xC"?2xC3@C *@CCHH#@"! : H F𽊃eeeуeeee#e:eeFHbx#xxCxC&6C%-3@C *@CCyH!yxHaywHyvHyuHbz#zzCzCC3@C *@CCkHb{#{{C{CC3@C *@CC`Hb}#}}C}CC3@C *@CCVHhb~#~~C~CC3@C *@CCKHQb#CCC3@C *@CCAH:#(3x3x'C"*2x C#+3x-7 C,0?xx?C .0x 8C'/7?xC 1@? C*@ CC9 C91@? C/@:C$H"#=2x<3xC#>3xC"?2xC3@C *@CCHH#@"! :HFFee„eфeeee ee+e:eIeZekee0F2Haj1Hk0Hm/Hm.H!l-H!n,Hal+Hl*H%"mcm(H5l&H}iz%HIwiz#H qiz#@ Hk!n=)1(#nBH)\ F0)x%#"h5-xf3e2g4xx$xHG玅eee҅eeee&e;ePege|eeeeІeF{{CPH Cbx#xCxxC'?C&;@6C C2@CCHby#yCyyCC;@C C2@C8Hbz#zCzzCC;@C C2@C.H-!{,H- a{+H*H)#|+(HF-.&6i0%B& H1"#2x3xC#3x4C"xC"C@"C @CH%}|b|!|| H{ee҅eeeeeee,eІe0FH]!hHYahHUhHQiHMh HI!i HEai HAi H= F0Ƃeeee&e:eNebeve0FH  !hH Hah-h H!|#@ H iiH F0Ve~eeeee pGpG pGpG pGF#h3`K;+$"h*#h"@BIH ##`#c`h`FIHh383` @B'd@ ez eFhDhs#B H) @BF1@i*~iK#``#P#"P#h J!+ @B BIH#hF ed eF(KFnl(#[BJ`8`0l(0`Ja0PC!#Jb0cJ#) b0`b F J0J#0bF e e ee_e#dF0(! `((I ~ a(! v`a(! o``( +h#``H`i ih @BF Kb Kc !rh0b(ecP( # e}bm~bh"B`hBpGF ,%&m Kh(@+B B Hn @BF m+e0Fj h)-h#@ F0)IH"h @B-IH*(m$",C"C K!` J h:*I HHBh Fd*e*e ' +eFj h).` )IH @BF. I H i(v$K4C,C@K`{d++eJ+e 0Fh#?"P33;#6 JX!CP JX1CP#2PJP2PJP F0<Ldl0Ky yC LxC x$#Cx#Cx $#C LQ"PKy%*@$dY+@@"@@"@ CQ0FF8+!F hh ` Ӏ i@` @B1ѡh`h`"PcJPcI2PcJcIPJFh hkl*X C *P :8*P"2C8*P"P#") XCP 2 `X CPKFh hQll+X &3C+P ;8+P# C!kP#!P1*JXCP"#RP;JP;JP;J !@IPP3VP@+ haF9#P1KP1K2JP2J2IP"2IP1J2IP!nPX0J@"CPX CPnPh+KPt3Pj - FXCPi"+ xhfkH) #"xhA):0H @B%c7(%cdl <$8?  e0F (!h F0K"`pGfKh+K"`pGffK"`pGfpN3hBHK`H K5`` c JKhhb@ B#C3XBXApfefefp( p#M("L(8(Q `(4({:!_( 0!KKHi(!KH_(! K h" H!#[B#` @B#efff#e$efpL##`K"`M*h*I##` h H\&\ `B L `:*`p ^Ffffff𵅰 )O*I"8(0A %K `$M#,`$L#`1&`.`0.(.N3h +'( #3`&Kh")0KhK"^J ^8). Kh +\&kfeffffffff7LkF%hp-!!`%`7fKJKJ f fN3h+$ O$;h+gK `4`(!"IB @(ۀ#[B%! "IB 4(Kj0"@B Հ"RCՀ"CB>! "IB 6(ڈ. F&!2IB (w#["@RB0nF0!F"IB(?#@bBTAdB?"C"BC#C#C#C!"IB((ۃ #C#CՀ#C@Հ#Cj(#@bj@b F0Fl#@B F#!"IB(!"IB(&'6?. HG @B!"IB(t epF h+ ЫB!hjhH[hk1`fb@FpFeF!.۱@  9(FIB!12HF\e%FmB ) "6;) " /#3C) " %F0FCh @B )j- G F0i H@BK+ !"IB @BFFCh @B )k.+ GFi H@BK++ !+"IB @BFF&vB1"#1 "(1(; "1( F&FvB1"p# 1"(1(c; "1(z F!F"IBL#"@BH&H& 6"'7@4B"H!H#!#@d"BЀ! Z:B" ajaKBHn @BaFKWSC"AJB.  q!"IB(:Caed ~dx&7A0F( F00!F#"IB ( t F00F( т#!"IB ^ F0Fi(@I!"IB0( ! "IB0F#;B*h$kh$ "@F"C@ #@CCh  @C# hC@C  @CcFCB !;"IB0h(? , !:IB0; @!#C :IB0K5(ڏ3e0FCj;++!"IBcj:*~#C! "IB %!"IB #C" "C! "IB cj+!"IB #!"IBC.KC cj +5!"IB #!"IB%MC !"IB K!"IB(@C !"IB K!"IB(@C F0 +;C~3{ +yu3C~;tF 0%FmB)#")K" )#" )#" }#)[" v F0F 0%FmB)#"[)" 7#)"C;C K)#" E)" !K)"@#C 6)#" 0)" 0#)"C ")#"  K L F0Fw0!F#"IB!$K"IB !#"IB !K"IB !`#"IB !"IB cj +y3C! "IB  !"IB #!"IBC F0AڢF&vB 1" 1#" 10#" +1 " 1#" 1" j F0%FmB)#"y)K" s)#" m) K" g)#" a F0p&%FmB63)"G)#" A)K" ;)#" 5)#" /#)[" (3)" " Q R F 0FB C F00!F#"IB!"IB #!"IBC !#"IB !3K"IB !1K"IB !#"IB !#"IB !'K"IB !%K"IB !#"IB !K"IB !K"IB !#"IB !K"IB (!"IB m K!"IBC F0S 0\!@F$"@[ +RB!:IB07$ @!IBCC :0HF@$p!F#"IB5!\K"IB .!ZK"IB '!WK"IB !UK"IB !RK"IB !PK"IB !MK"IB !KK"IB !#"IB fj.5!%#"IB 3"! t+"! m!#"IB d !cj+!"IB "!IBC-J C "cj;+#!#"IB !"IB bj0!C8 ( C!"IB !#"IB @Fp *2C *2FK!D!( F!3M! Y!KFHHHHHHHHHH H FF(+f+f(,fh,f,f,f(-fh-f+fh+f*fKFCliGFKFCl[iGFKFCl[jGFKFCljGFKFCliGFKFCljGFKF[h(HzKh(FFdfpGKhb`pGFfK0Fh%, F0P"!hF! K K K K KhF KjFfbbbb%b5b K0Fh, @B ) (jK` F0ffKF6& FKFYh#[ CJFS`biGFKFYiGFF*F&C F)KFhBЖ"BЖ"BЖ"B"B "RB5BH!l m!HdH_KF` HX (`HMHKwedPeKFiGFKFjGF0FCj G F00Fj G F0KF Kh#@KBYA KIB@ K HKFhH FF0U! KF Kh#@KBYA KIB@K HKFhiHF0U! KFHF KFHF 0F (H !lH!h F0F 0F x( F04KFFHpG-fKFH]F-f{"CCs   p qspGP@KF@"}B#q3t"rsKF0F !q##t3) #r F0 "}BppG"}BxpG}#@pGKFph + @BF0F`l(I"5(` F0F%qe0Fh kh+ИG `a` F0& @BKF9hFKF2h3Bh1``hhFpG0F#KFn-[m+/H+q I( +JFf q (+!(( F0 @BϾdKFhXiCFh#[BCaa)h#C`h#C`i3pGF8D8!8 `(- Kh"@ZBSA J[B@ J3`) h FK @B0U! @x}0Fl("IRBRC"#C#r"lIRBEC"#C#`s F0F/e@eFh,<'2#2,3BрFcl;Bj,<`kh<8<="42<3BCl;B>k(<; @Bez zW-C BYјzz-C BOXe{ {׈-C BEe{ {-C B;՗z%y B4јzey B-X{y B& y(.$0#BU{Ly BՕ{y Bј{y B [Ջx|CBXAKF#Xhkj+ИGF& @BJYBKAxppGFfF @x  Xhkh-  !GF& @BF#X3h0jk }?h/0Gkx+ +x#+ xxC+у#h3#`F& @B0 F Xhkmh- !G F0& @BKF#XhkiGFKF#Xhki+ИGF& @BKF#Xhkj+ИGF& @BKF#Xhk[j+ИGF& @BpFt h,=*3,2B gJ#3`p @Fp!((,iF((( j,=, Of0F, ?t( F0iyLFDO$#C%"` )3#PkKPf`h3#`gKP *v(9y `9#33c3 6 (0ѓ#Xl #hl(Q#[B#OJ OKPNBZMJ"!  {u &vB0#DF kl1@3B(  z#haa;h3;` T;h;;`- *+P(I (( B(Huh++6*(51h  h# kiCa+FF % I Ѓ `P, $ @f@f@fe#d e0Fah HV!"  H )h)HG F0H@FeeeeFAK't p0f&h,=+1,3B&єh%,<#1,3B8h+Cv  .'H'Kx< Fih#H(3H@6j,=(HK6pcl+B Cy+ ij,Ch0^`砆wdKF FF hk(7/7;h ;;` .6003h"@"B&vB"ChB#i1h03``1[;h+ݨhX B HO&vB`ifhc `0FFCdKFKXFF, FKX8B ڕIH$ F+#B `C``#SC }`(|``; a n`a(j!h !`i @C3[h@ @#@ [[C  #[@# BB%SC3ChIC  `iIC 5+h+ݕ#i2o`h# Cg i`1}01whw(ۂ`ih W`#SChfiZB+`3"C+`#ka8.azh#*:SBSA"CC !Ck`,K`{h+J;BA@*J)`8 C !C"C`"R` 3a" sa" a" a1`q`+e K@ F[cDGh(b|+h3+`F, =dd@@HFFF " !(. K;ZAJ[B@J1($ 86BHn$dBB K1X( F$dB$`kd, F'KX"C:+$+ KBYA1 &0 (HV :`"!8/ !*#@SBSA n% ##@ 3 3#C:`[h+ ]B]AJ$@RRC"@22CxK%C+C* Qh")9JBJAC{`#`9~:$h660I ( kj-Jh-I @!` C`"$K29 Fkj"@2;`^`3BI W(![hBiVz; 63C6x63C C;`h{`0 27# JP3P @BF'dfib@d!F ) x+k;x+$dB/"B4#x+9(8(\=+g<1ydbB2B ";pH*1 FFd0F y F0 KF  gFFe0FJFUjH-j !} F0dIFFJh#@BK! (@h F1 " +HF0FD.f0F B( F00F !#x  `xCxCxC#yCcyCCA F00F ( I*  F0 @BF_d0F~H) F0d0F k(*!{ F0KF\( x 1+ "CY+T;XBXAF @BKFH8CBXAFFTd0 LFJF #2 #BKF3 F0dF (KK""C#"IH2|( KHhFKFYh" CZ`"Yh CZ`FddD.fdf#dpF I M L&#C22) D@FpdD.fpF)"J1 vBH!* @B$HJ#1B JFQh# C S`@FpK Hh!H)e FdD.fdfddF$OH"!B K Hh F:1 (` D.fdfdKFYj)H FdF x +x$$+-Cx{+/7#`+##0K 8(,K"!+(K*(K43`"ZP F+7 h3 ;BB45`+(In5; h(+ IU36FD.f{c4ddddKBYAIB @pGKFFKFKIH[B FAhB0 hKx#p"X!oON;h+H#;`0`0h(H"("( ( p`睚dT.ffde𵉰h )\Lh#@P(*Le@Ch)RL/w 9#[B! x+$/e/l/DH`#[B! x* ѢB#x0+cx "CX+7K8H\)" @B #x1+Y+ E+0+cxF;-J@f;+## kBx).*3 ;*п (йhHԂ) H_t(L H"!(bFe+dMddAddd `pG L K' MB %()h0(75Bt!#")h}11 fdiFCBXA O`h#Bq#[BK& h@BZBSA[BCpGFf "!=hq K[lih i #[ FcDh '@ !#iA2BѰBA !/!+  + @B !:iAKA @BKA+; @ #@-1"# ; B _ # !`Z`q 99 @ (ڔ@ ;>B B>+0#B,B)6-93,B  A<!3"[TA9$ Y(< 3A[ 3 C%" ;B!%mBFf H0h( Hh(  0 @BFff𵉰 Y( H! @B ;3C(dph+ChBуhB ) b ` *!0( q pf`` 0!h@*ѝj iA0𵉰Cli 9.:!. Уj+h+0 Cli+Уi 3@?(;gi7KC8@3^(hi 3@i)0j9Z9E0OCZi 3(@"9/CAL#hi^ 6Clij#@B}= "hi& 2(3@I 2BF؈(.[F#[B3cE XCXBXA[B@ #KC #Kh#  YAM2((+h+[FEhB/(e H/([ @B 2B"hYAB(G3 + 3X'@! @tL 3%hBS-$9 :)ZlH&`.2kK"`kKRB`iMmeL*h@#hB-:!\("bH_N3hB(q#`3`"[KRB9 `:'%`-UH? 7`m@+`PJF"hcD3XC 3 2B-%9 :)&`.@H:K"`9KRB`7Lm@#hB*1K:h!(5H.N3hB(#`3`")KRB9 `q:%`-7`m@#`$M,h,O9 Z:!.`.HK"`KRB`F LN%h2hXM@+hBK:!(?Hdf U!efk!eft/f!e!e?"e7"eff"efp/f"eN3hB #+`3`"KRB9 `:!O,`,7`#hX@3`*h-@ @SC-%9 :)(&`.wHwK"`vKRB`tLn@#hB*rK:h!)(oHkN3hB(>#`3`"fKRB9 `:%`-7`n@#`^M,h,+9 :!.`.WHNK"`NKRB`NNJM3hY@+hB*KK:h!(IH?N3hB #+`3`";KRB9 `P:!,`,7`3hY@+`9M,h,=9 9:!.`.2K"`1KRB`+N3h$*Kh*MX@*hB:Y!@|(3hY@+`KhCN3hB #+`3`"KRB9 `:!@,`,a7`fp/f"eft/ff#ef0#ef#effl/fL h( SJ#`#`"KRB`L h( EJ#`#`" KRB` L h( 7 J#`#`" KRB`fft/fffp/fffl/fp M L(h(!h)}11/#+` h(##`pFff𵏰:a2h`3ya* #`hhB!"#$#%h+0mBۻB yiHoh( &#x*wkF;`3iFF{`#{hh+20=(>ی! ")d,33h#`#39jg&#xzhT'#x+"2`+l+{i+;i+Ж%+T{i+;i+y%0h"( h g#3"` +{i+;i+jEH7EHzhh2 K;hFhU#B{i+;i+(:H#B{i+;i+;5H{i+;i+72H{i+>;iJh3`+!(*2h+3*o(h*(ЫhZ`3ҹh h! .Ъh;*8),10(h"T!(T3x/+xi!M Kh}33{a#"yi0`0-ьxi!5;i+x+shi`zhi`h#![#"#((;jzjC0Fff7# K%`B >(,8CBXA ,8FfO 9h#B$N}13`13("2h#3*Уh +`h`4`o h"(9h}11 @Bffp! "!M,8 vN(-"KB)l+р3``;#[P!3P%3"P2#32 g((4`p#X3`"n ##3 N#3` fS ]K!` KEd"h`h`h  MCliI:)0 `a`ff 5I+ h"@l PFfp$$Fl qii A"+p J0A$x+ЈB0\%B 3p0F+d Jph ( @BpJh"iB FHff)Ch + +=0KBI0H1 .KB؃!YC09iB! kCh^"hB(ach+2 +, +#{C"h[Hx\  "B +ч0kGC !yC0a#GC{C#hX#hZd𵅰 `` Ê\Cih#B4C&1nFrFjDCz`hB ٵFh+8 Ficzh! ;`B(еF @B窊yhh/h`cih`+#hZh * 1`ڊjQCB##ai h`(#h[h + ;ZBSA"[B@"BKi+(a a[ ;aix+;ai 3a3"d8Ѹbi;bhibzbx)z B10@B@"BxCZ{"Yb#x++к,2#!p 1"XCx2BB,;:3,2d>-66"!0#"[T5 2+xCg#{թ0#z "Ck!.#+p1:h#{!h#+q "+xCFі#![)p\*AT;3l*@ {%ak\+T+5-#3x)T) 53 -#r+ХskA 5V.R<,4!`A* 8!A2b55*2Td5+x+/+ \+ ((+ @B5 63x+/+\+ci+r*3I(T(#hZj``[jc`#aa#a3x+.)I* ('78lQsB9l(( !-1;l1B((i"zB!hCMh" -тc`+У``#ca#aa#aKj``Kjc`#3x+ЊՋ Fpe5dpLH#h+hK#hHYh h\1 H$ p!iD "(&!*iDHruuHfddeddpI iF"1(m(j`B`A p@𵏰 I+"((J( "(3$H7(4 ii $dBF@𵗰I (t (z"!(ni i ݊LF (ъ ! `Y`BTBP/. 6OABBcFkC%-B9B6AAACчBB1#1C *#[B ! (UHk +;ZBSA[B"+@B_AKK3! (GHK(dAA2i(P h[h{A `K`C! u( +(;ZBSA"[B@"B%BB! ( h[hKA `K`sK) @CB 3! ($Hq(m +;ZBSA"[B@"B]_AK@dd  h[hKA `K`)A(/ +;ZBSA"[B@"B K #[B 𵇰 (iH)o  dI !J!/>7)7118 "8#[Xb(_5` $dB778 6("R!0 # X0"i"z@B#` .`"`i#a`a @B#[X pGp! 5 xcyy yI0(p+dL"D#R3QB"BKDxpExTY|P- ЯB ,]<_p3,T40"_]Yp3Bd Hx h xC CF%" "mE=80 0M[+@&R*@]s@d@3&3@3C-Mh1%&62BѥB=x@eC- 5B؀"Ce27B,dF p DF7 $]mFIBaU4,1hF7 JH`%gh./(#B:#(3D(1c|"|C|C|CB%-IH!H IH2b}#}C}}C-b|C#|C||C6ChF'd[ddidodd 3Zx/*0/!0 "1v,MI(1*1B#BSU88B#"BsUV M I(}B(y I(u #D{[]sU5Fdddph,!h#BH# MI(PI(L ph!C`"JC1!`h1`!``*h3BS`+`k`Pdddpj,pEh.#s#b ;pcs#" ;qT# 3kr#(r! l"B! 2BЀ! F:B2eL D 3Zx/*4 t#;p3/! #x+P !`(HMI(!(I(.5*!t!I#RSU08B$# 9cU7("Rx+ЪLI V9 RI N##Ds[]cU5 [h ++љLI 44 0I , iB Nh0}[}C}C}C %TimB",0+-മ(10@"!8TkCC*26Ck}*}C;k{*{C{C{Ck*CCCsХ6! 0z!  0<0#Bd!0 #)!I0KBKAGJX0"ZCEI#RXQXB۳"SC@I zC[?I 4 R"(6B BNHcC!C" 6 "CBѢcC!C"2(16" C{B7KZC"A5JB4H0(^i`c|"|C|C|C`c{"{C{C{Cacy"yCyCyCB3g )sB^Aby#yCyyC$C4#C& "HMcy"yCyCyC +A )= "H88F'd)\(\(e.eWe I( !p#(IH#;evddǰIn "!D(IH G~h%.q +H}i-9,hHc{"{C{C{CBЮ#&43562xx%65C+x!C"72xD1Cx3xC*xCxC"Tx/+.;8I+${idB"+r, ۔Hb#CCC+~i.f(ۅ4hH{c}"}C}C}CBAc|"|C|C|CB5+yIvHZ!# wH(3SvIvH*Ncb}#}C}C}Cb{#{C{C{Cb|#|C||C-Cvh6mh:iBhBh [h3iBЅTM(4h(#,3x3xC".2xC#/3xCBiӰh(+"#=2x<3xC#>3x!C"?2x:-C#x03xC#23xD1C"32xC-kA5`h+7"#-2x,3xC#.3x'C"/2xD7-C]#83x*ٽ,Io"#52x43xC#63x74C"x9C(vh #kT1cFx;xCxC#xCB4#' FD!576074F:edd'dd[diddd#43x3x8C"62xC#73xC"02x2x C!21 x34 C"x C)Y#43x3x8C"62xC#73xC"02x2x C!21 x34 C"x C)#43x3x8C"62xC#73xC"02x2x C!21 x34 C"x C)]KIIFd;dYd.IC!21`P`` 2)]i '-$Ih#Hsh2h Y5 6- ,hH#83x++{CX2P"02x2x C!21 x C"32x CYhZ`"42x2x C!61 x74 C"x Ch`mhGqetdd'd:*`pGP$' Fhy2x*A:@@-5q4BbF6q`#F idFY* LifFYB݊iYhXhyFx&"A[2@, Фq h5B#a @BdF4q`4K3K(:(p\h3`#[B,3B+<(!0. ݷ9(#@3 0@@h`#B"C@#[B#3BЇ?9(Z$@>#4@@$4$d\T3 i#p`"hB!ChB$hB pi dY2Di[cPiidYuYdtPhX+Ђihh]`Q1ii[hiX4R`Bh!h"h i!"h`i!L#Dq K"P3 2P ISPKP I{SP#PKPJ#PJ!IP  PIJ NPQHɪ P"٩PJIPK "P;CP#I[P CPICPK+Pyx A@+03q!(- _y+3qZx\x!$-p"8 G CС#2 q(0 !S!$L!7FzH7}H2H-B"rH%,B0rH3B݂rHFaD`! pK_I]RXP(]JXh2`4UI(c( "XPYh2`(/!IBB(FB X`FPY4hF D`F`?HXDHbDR>H`X(!4# ! 4&I(*4k( *JX+IP[Xh2`(!xF*4$(OYO]PY:cDh17`(!Z4$ !R 4  d(c "Y!3HX"!% -XY"!XY#p" !XY#"!XY#"Y"aY2bYM(:ZbXY`:!HX"!H!X "[Y "HZaH!# (@BKD F IF" h FFhOQCi+ F !&;h+[iK*( K>&` l`B67. #k`FPfFx/+2"+ѥ#/!!x/*!Ѐ! 0 >! l 8!  2.+( eIeH$V3p3Zas`Z`ash[h'aZ3hi# \8RKBi"3a32#wab23xx'87C9[(>[B8"#)2x(3xC#*3x+4C"x$CjO0LIF,  +K\+ +H#zFiiZ \ KBqji'6kk %k " Tz/+ЕBM+I Z"Z: : # %-+x+FZd\e~eeeFF*2K2H#1J!XaX%mB(F+I_X{i+:i$J(H* `F`%{hh^Xh3h+еibFG`3iJ!HK#XaX``;iJ!K0XaX#Md,ePfleedFCi3hi #C' ;" B Ѓр"R9( F"#)2x(3xC#*3x'C"+2xC;B(b|#|C|C| C#,3x3x0: C! 01# BѸB:)i J KX!iX#H%!mBTd#eKFH(H(HF/fx/f/fKF(CBXA@BF NF3h3hI YX# X" J!P0h! 0 ! l !  -+("ѾIHT(mj $dBIHG(`+ $dBIH:+3hSak`Z`akh"[h&a#*akakhb_h{i3hi#KB^ina+abBi"CKBEina+ab#23x3xHC"#83)2 ;xxC#*3xC"+2x26C#x,3xC#.3xC"/2x?C#13x+uH+tH+tH1hlJ BnInH2;($ ]JX F bIk0K`I0\K?! 0#Bd!0#)!I0KBKADJX0"ZCAI#RXQXBZ"SC=I[ QC :I xR8I jj4H 3Hii KB\بj&i+a#ka/#NF##JBqCcF!HA#BrC#IA#B[AJXB6`fd\eΦeզeڦeܦewdeQd@dJejddee)\(\ ף  I KRX9aX# Hj#"b#*aka$Fãd!eFO;h"3h KX;X N!Q8hY CAFF`fLF#h3hKX;X"K)P h h0KB IH*C KXs Fjj$:`{`$dB`fd0eFN3h3h"# `K`# Ѐ!HI$dB FIYX#X"SJ P0h"(0hKB مIH4JX jjBєB "|H+$dB0YA;C BBoH!KA C  # )aA  #C   B`T`$ jj2 B BBNJ#]A+$ CB 2!D7GH!q{B+_Ѐ!I (#>I?HH $dBi2I8KRX98HyX#6(O5H /`S`` +:0Ѓ# 7**+)2x(3xC+*3xC*+2xC 3 (р"R: 0"CС $dB$dB`f_ed0ee0de֫e&epGpF H !# "#)HH @FpF eUd/e0 LF#h+ М3hKHX#h3h##` F0`f e!C\"B CCT1 xC ph#j CbpGFH# ;(XJ3 + J! KHXiX#> FFңdse#F\#@BKX J! K HiXX;!( F$dBFԢdȣeKpFX J! KHXiX# @Fp~d%eFKx xCxCxCLJ B&.u&vBcIHHJ!HK3XaXu&BJ!AK#aXX?H) vBtA } ).f9H5J!5K3XaX&j|+|C|C|C.KXB) X)KX(ѓB+)#\#B#3x[&0FBB.H) :1@B?ky)y Cy Cy CB.r Ht&mF1ede%mB#9 #\ " @B &J!&J%HXaXY(Fz|;|C|C|CB#\ ! @BH#XKXKXK H!]+B9 FYe_deڭeeF hhB= hB7 C <@YCh Y0/73}BB8H8K#7J!XiX 2J !/K0HXiX#$1(dB  1( F# 2(AJ3Ѹ' 1(B J!KHXiX;s|2|C|C|CBKH#FYedeeڭeFO !Y``(Y!g!0 c`hfe` @BF#%[B``eaY#X9(%b&`ba'aF|0B{#BCCspG0h#ZZCBXApG0` pGKF0h,FpF%`Y(ѻ&KXBM`Y#cQ@FpjcQihS``#`aChh%S` 8``aJKHXY+F4dd K0F!hqP"!0 F0F\fF$3FF%#n`nB#cfF@hcn5k0F !I ( aDalx3S`g"H2gd#Ce F0KFoox3J``gg{ FNF#Y*3@+рF!I "R)qQF`fj+#bCi3h2`pGKF)Fj+Ci3h:`bJF#Y-iBI3@+3h~OCm9 !@@i #  Th#C"`]2#x\3xC#^3x(C"_2x. C#`3x3x!C"b2xq1C#c3x6Ck`#d3x3x'C"f2xC#g3xC`#83x3xC":2xC#;3xC+c#P3x3xC"R2xC#S3xCkc#H3x3xC"J2xC#K3xCc#X3x3xC"Z2xC#[3xCc#@3x3xC"B2xC#C3xC+d#T3x3xC"V2xC#W3xCkd#h3x3xC"+12#x03xC#23xC"32xC#43Fx3xC"62xC#73xCbFb"bp2 xx C"r2x C!s1 x Cc!"m1 xl2x C"n2x C!o1 x C"2bx!@ (0 @@A{CCAs!")1 x(2x C"*2x C!+1 x@C",2x2x:C'.7?x?C"/2x:C/7!"u1 xt2x C"v2x' C!w1 x C"x2`x2x C!z1 x C"{2x C!r`1" x2x C"2x C!1 x C*2`fFbbbSbF{RCCFs&VhBOhbELbFJKX!qXH#L&i J KX!qX# H;!) `fKdede&vB =i7J7KX!5HaX#5JC{"@* ,J.KX!qX,H#&R!IB3"RB0؛ +,)+ +/7k#B[B01ic(!k1kkT ( F&q&o&m &k & &vB %mBFdޢeKdTe0F(IcZh`XB``"bPZ`cnB ! b#3h#X#3hKX#X#3hKX#3h~ d KX L#h+М3ho hl F0F|`f!F  H3 Jddeb G( F $dB a ")hl0#Fʚ;Fxu+#[BKHh" h FSxb+ѓxi+x:+!+"y*!" O&\3B "` x(w")1JB؀! a#2e`{J%P::PyJP:[`PvJ[`PuJ[`Pt:[`P2[`P2[`P2[`Px2[`P[`iJx3ggPgJ[`P2[`x# Cp@#C`=;cAc#`Yc[J[I,PJB+ __(Kx\3BMH"  x+B"(t:(!(:Kx+61"( R]k67h- P#\"@&BhX4K`#;`1K"X;Xq/KP#KB,K7`c#[` #r#X!ZBSA"[S``$Sa!Kaa=h"j\@@CCTj%x] @ &[CCxU\#B,H->KXk/fte+d$"c"c`f$Lde 8X(CTKX+й\# CTKX+є"\; CT#XKPKXKPE33XA;;PI[{PKXK!PЀ @# !B#9 @B9 @B9 Bқ9C#9PY33XK)PЀ @+ !B+9 @B9 @B9 Bқ9C#9P#BڛHKJ!XyX#!&vBF*#H,cB ЎKJ!XyX#HB!()-kBм,ܽ{K XZB?1@9P}I~HY@9P}I xP|I @xP{I xPzI88xPyH8!9PyH $QtL%9Q$d|QrMyQ!|PpI <<|PoL1|PoIxPoH1xP71 @9PkI0[@jK!PEiK<42PgKB8"`г"\# CT@KXB 18'(T"\CT#\#\" *@@BD*Oл#X7KXMKBMKMKMH#U%mBKK.Xj#Xe;3h`DKX\;3hW8=_?HJ#P!2P-8JP#P26* /J!JXyX1H !@ ;3`(V %Ft|ϧeşdeae4|\ltd0TLWeiede|e63x Հ#X+р% h! 2#P(#hB%`!z\ #C;C{T3x"C3p$:]#C8;Uh%;] "C;U3xJXZi*iJK!+HXyX_~M wKX#zKX#"0`q`X!ZC02zPrJrHX&(19P 2SC!/0CQ"0P#3iJCPiKX;n3RB@B[JdK!bHXyX+%nnYA  @BKA ! +# :gEJX2X!XC8#X0BJLHK>J!XyX# #CJPBK"P32Pn8n 0Dn$%# "$MA 19  C BѠB )8gkAygB Bټff8BKJXX!zPJXHJB[;@@) ;3`(o8n+}f $dB;3h%|PfdeLl<tdҩe e0!  xf(:n{nB(3x&2Cp{n <3xCpK"IXX888/#P#h[h8`#`Y`IK|XX;n L5j\cKCb &vBVqeLLu#code@0FKh F0F\fK0Fh+М3h#" H!lK BH!y @B F0`f/fe# $"V*+0cC0KF# )"}+0FK0FXK@B@! ##[("v =,  F0 $dBt#F\#@B /H#[B F)KB Q2xP3xCR3xCS2x}1Ca|3 xx C~3x C1 x Ca*#\)%J!J#& HXiXi+=#[B Foede*2x@# Cp~**~ #PJ3P#(3x3x/C"*2x7C#+3xCJP#,3x3xC".2xC#/3xC"P"#12x03xC#23xC"32xC#43x3x C!61 x C#73xf Cf#83x3x!C":2xa1C#;3xC"P#<3x3xC">2xC#?3xCJP#@3x3xC"B2xC#C3xC"P#D3x3xC"F2xC#G3xC3+f#H3x3xC"J2xC#K3xC"P#L3x3xC"N2xC#O3xC"P## x`3x C#b3x C!c1 x C#d3xXx3x0CC#g3xC #X3x3xC"Z2xC#[3xC"P#\3x3xC"^2xC#_3xCpJPb#CC6C#\[#h3x3x)hC"j2x1C#k3x(C `!"l1 0|"@@@@C;x2CCRK>pXSKPE33XB I;;XB:BHKP#XIKX # #0`q`P?J#P8KX XP:J P:X Z#P.KX  0K P#P-KX+\~+ZbC"C$H2C.XBq"H!J!J!XiX#J!KHiXX#!(*!JKHXiX3Fl4<DLdte|d±edeKIkP#TKJ!KHXiX#f#T3x#@;x0!CC;pb0CC"2C B pHy+ܾ +ܺ +ܶ +ܲ+n  3[BۗB\J!^K#XiX\HU#XBTKUH#?# "nnBѸBMHEJ!GK#XiX(  c BчB?H+Vю#X+S;IiX 1KC 3BK#X)Hۀ#[B ;  B: FcDB5+3x0! @B0# +,ۓB*сB'#h3x3xC"j2xC#k3xCJ;B#### # # # # ###7cd%8cdTee|d6eeeNelɚ;K!FX  >60`(# K"X!8i KB٤Fu48F(P`FFF4|Ch+=hi+>*jij0hCi "#K"X!83KBChB*hii*1Bij0h"10R (;3 `2h)0x(4!x C*1 x+2-Cx+C%C#p p pp3hYzz Cz{ Cz CZ{Q4C{C{`C`Z~~ C~ C~ Cz`Z C CY CZCC29aCza02x2x8 C21 x0 C32x C`42x2x C61 x C72x CB`82x2x C:1 x C;2x C`,2x2x C.1 x C/2x C:c<2x2x C>1 x C?2x C!zP@2x2x CB1 x CC2x CBbD2x2x CF1 x CG2x CbI1 xH2x CJ2x CK1 xM0 CxL2xCN2xCO0xC"`P`x2 x2xCz0xC{2xC :P|2x2xC~0xC2xCMH:P2x2xC0xC2xC :P2x2xC0xC2xC;H:P2x2xC0xC2xC :P2x2xC0xC2xC(H:P2x2xC0xC2xC H:P2x2xC0xC2xC :P2x2xC0xC2xC :P0x2xC2x |tC0xC"P2Fx2xC0xC2xC :P2x2xC0xC2x$xCP0x$CR0x CS4$x$CU4$xT0x$CV0x CW4$x$C 8`E` >Y4$xX0x$CZ0x C[4$x$C\0x0x(C^5-x-C_0x4`(Cp` >a4$x`0x$Cb0x Cc4$x$Cd0x0x(Cf5-x-Cg0x4`(Cp` >i4$xh0x$Cj0x Ck4$x$Cl0x0x(Cn5-x-Co0x4`(Cp`q4p0$xx$Cr0x Cs4$x$Cu4$xt0x$Cv0x Cw4$x(3$C  8`E` 8` A`x#!PKXBѬ B,>KJ!HXyX#;3h8# &ii J K! HXyX# #[BF&Fڟdeםd?e cD;P  #KX  YA#K0`q`X  YA(`i`p9# Sp1# $pp h:\3p:PxXpxpxp h0xP2ppxPpxpxp0yqpyPqyqW3yp h)xp2pixQpxpxp)yqiyQqyqw3yphhY! BӥyiBв;iBӮKzhB٫:k*ܩ#X3Bݢ{k+ڞJXBۙJX :BВJ;3XhBۋ"X Bڄ;3hB~[{zJ;3hXBu"XBo#XBj Bf;3hBa B];3h (\-SBP&5@ CK`K"X  @#h[hB7B0B,#"XXB%LJXB JKX+IJXB#XBBBKX+ F)B#XBB6KX+4JXB;3x0KXBB#X+"XB#X BB#X+ :B#X+ڼ Bܸ#h]h-ڲBݮ B٩TtL<t&&BЈ#h[h+ڂB!yhIh)yBwѤ]A"+ KABnBj؛#\hh#h]hkAKAKABSBO BLBH!BDѝBєB!Bo##;3hJK!XyX#H ####### # # # # ########## #FdˬeIKXL3XHKX2 @"Bp4 @K@P =KP @[!B^#P6KXЀ!I "B:!IB:!IB:!Bқ:C&KP%KXFЀ"R B8"RB8"RB8"Bқ8C#PZ#I[,#zP":M24@1FL4%m $BPbFBCR2%(@ SJP2XJC2,@m2bKA YA+*YA#P83`Z`B4YAB5B0(KX !F @BYAiA%TBA&,@ @2#ADKAKAaF `K` $)C AKAKAFt ) H2XiIi[ @H@@CpGFF3x 1kiB.3i;+JX+#X&+3H5hYh( ) @B KX KYB OYB)ۊB 3B FF<x1F6 'hh:@+1(6BрF KpX#<%BCp.@3C0F F3xIiciB(&6x44hwh, KXBK X%##@/B C8@C B6BF @BFtpF!#!MfYhYh2IAYA"RBKA1+mJXHBKXcYBHJ!K#XaX D @B@Fp s#3x"@ J PF4=ere,dhh $0..8(y _x"@x2AC+`8#@@@ `x_xCxx_xCxZxCxyC?8(J xXxxCXxx6x0C^xx6Cxx0C?F $"H #B J L J!XyX #[BFFdd0F"c#B J!JHXaX s#[B F0Zd1dF#(9#3xKX*xa=5x7OY(`Y"h`)CA@` hC`5B#X1 UFF*) Ї#X #YC#X[YhZ`pG0FJ hX+ h !AC[i F0#X"X#B CPKX3XF z' ;B#hC`B!J)X3P, F!H M.H")h#Cc`3C!`# 3P1h*` 3BѪh#C J`X)3P0+h+h "JCb#P $dBF#3iF(0#3xKXhFCxa=5H7#XhF8#XKX3B K(`XhF'h` 5BK1X wFF<#FX B #ZC2ii! H f#*5"2xB9 pa:1 5#3x9 pa/<`;i;3a7``( F#XKXK X h 2 GJ! K#XaX H 0#PKX %mBde0 $TCF #j+a#j F0F #ZCj(а"!X ix0i ѧ#*T"2xByi ha.+x36LK1X3` `6B:) (F@J&?KYX#=H 2 :)6JyiX NY5L#1 (2H#X2 (*1 (и#3xyi ha #ZCb"`ki/`XH$5"XBZ+`5B"X %3P kC)j(jF #[BFdeeF' Y) vДY0SKBً#X'NKXm#*A@KKXB-!0FKBrz%+B4#hC`B"X3Ph "JCh0"XiS'#@3$\C<L!0/K=BC0x*KB;7!x Ex"!ph#C{`3C`#3=;x35h+"Ѣh#C"`X %3Ph#hjC"Xi0h#hUC[b K<B F*0~53B $dBFF)$ FYK!X #XC w#P( $dB!8PJ#XXB! `#P(3HK&v ! O `(%e`` 4Bр ) @; 3=03h 3B?h/%h+:3 2+-$JsX/^B:= 2P5h) 3 !YCUX-3 2B#XKX#XKX#X#X#XF| $< Fcx x Cx Cx C Y 7td eeeeeǸepe))hpG @hF,Ccv+hXB6*hXa*hXP*hPa.Ts+hX4BF>B@ݖY8B7Q" s00Hk+Оac6 hd3hCd*kkkeddcF`;3 `2``"(`a `aFh,!pi o<21 (0!! `"32#x23xzh6CB2 h80 ( {h%B@AB(FCE% %mBFh#h! KC01Y( F( +%#(ИBc '"1#[B#`-P/N++3`#`''("h!JC3hhFkEBkFPhE01YD(((3h#h[i;B"1(Ѓ8+(-/3`#` (} !yCkkhBZk[hB01i(e(5`'`(](Fh"+z B>#h C` @B0ѕ!CX3CPPICX;CPOI h; `cihF#cF ChYhA`Y`cF@J90((F#X! cЩ#X)h"C: C#`{`h" C`*iB ѕ"X3P)KB=8yi80%B*ZCX*`3ci+ѧ``#a"ih0_ci"F#cF3Chh[hA0 `K`) JcF``#acaЎ %mBFLfF37h;hi @+ ;h!i `6;hi/+' h+ Щi7FbFBPYh))z"B)h)?Y"ZC030 KB/ K"YZCk11 @BF?F3h7*9 @KB/9(ei=6BBea-4ܕ%&i$h[Y;SQ1(+sh+4гh"C`JJX3PHJh3`ci+%}C;ecaciB#h+ci+#i+% !(F"10170)("H100k~+Пa57"!'O&06B1B#7`a;h25+k`#l+`cl;`3`"X;Pch+ b*hhW(Сh"C`JX3PJh3`4LfF0, e /4,`FF3h* 1g/KB("`+29;i++h+#+`+h!YCzk*#`01y:>KB F`(sh[;++h3*-#[B+`()h#KC0hkBqh[kB$`F (W/"ZCk8`l`jh&R:sC* 03 F012 ()) 5) D(sC01Q/k:`l`kh[;+ p @BF p(  "hch3( (( F('_C800 #Jclk(|#dccdFkF-((! F (pF (! @Fp#\[!#) (Kh+ z KB () 5FFF(I#\[1(4Kh+ z(H0KB $1(,&^C000 H#"Jslk(3dcsd1 F,*2hsh  3( #\[" K!(  1(2!(eF 9ژ(; Kh+ z"BNK Bم^ kiBMs.^$tC#[BZC04,Blka)Z G(P#KC BEJX3PJh3` ` `#`aFN%O#YaYH Hi##YaY # J !KHX#aX  %mBz~KX 3cFSCh `iJ`]xx-Cxx*C6C`]yy-Cy*Cy-C a_zz?CzCz#`#:CJaXBeKXB - cNYB#&+@5BcFVJ!UK[H#XaX #o-bFMJ!KJRHXaX u#~ +H%LN[YY+ѪB;>N%=OEHYaY WAJCHX#YaY L#UBۚB/N%.O#YaY5H 9#X0J2HX#YaY )#2#D1hiQB'ChiB"!JK#H#XaX #[;+! JKH#XaX #0 % #[BF<Lfd5e|eelee\0ezeee0eF OhhC"ih1ci:($(!hiiBbhB#i Jh! K HXiX# (1n @BF(dep#FXth++3h`($ JH( - LJY( !(@Fp J HJ H J J( 猶ddsdddddɶddH +JXpGdsdpGFJx xCx xC C?KB>H! "3xHC"?2x C "#A2x@3xC#B3xyHC"C2x C "#E2xD3xC#F3xpHC"G2x C "#I2xH3xC#J3xfHC"K2x C v"#M2xL3xC#N3x]HC"O2x C a"U2#xT3x CUH V"#a2x`3xC#b3xOHC"c2xC#d3xx C!f1 x C#g3x C 0"#Y2xX3xC#Z3x=HC"[2x C "#]2x\3xC#^3x3HC"_2x C "#Q2xP3xC#R3x*HC"S2x C "#i2xh3xC#j3x HC"k2x C !Hl1=e@eee/e6ee6eKe_eseeeeÙeٙeeee)e=eQeee{eeee˚eb~#~C~!C~HCc C C C cCHC"Cc C C#3 C i"#)2x(3xC#*3xHC"+2x C T"#-2x,3xC#.3xHC"/2x C ?"#12x03xC#23xHC"32x C *"#52x43xC#63xHC"72x C "#92x83xC#:3xHC";2x C "#=2x<3xC#>3xHC"?2x C "#A2x@3xC#B3xHC"C2x C "#E2xD3xC#F3xHC"G2x C "#I2xH3xC#J3xHC"K2xC#L3x3x C!N1 x C#O3x C "#y2xx3xC#z3xHC"{2x C "#}2x|3xC#~3x|HC"2x C q"#2x3xC#3xrHC"2x C \"#2x3xC#3xiHC"2x C G"#2x3xC#3x_HC"2x C 2"#2x3xC#3xVHC"2x C "#2x3xC#3xLHC"2x C "#2x3xC#3xCHC"2x C "#2x3xC#3x9HC"2x C "#2x3xC#3x0HC"2x C "#2x3xC#3x&HC"2x C "#2x3xC#3xHC"2x C "#Q2x-ee6e e!e5eIe]eqeeeeÛeכeeee'e;eOeeceweP3xC#R3xoHC"S2xC#T3x3x C!V1 x C#W3x C J"#Y2xX3xC#Z3x]HC"[2xC#\3x3x C!^1 x C#_3x C $"#a2x`3xC#b3xKHC"c2xC#d3x3x C!f1 x C#g3x C "#i2xh3xC#j3x9HC"k2xC#l3x3x C!n1 x C#o3x C "#q2xp3xC#r3x'HC"s2xC#t3x3x C!v1 xw4 C#x C b~#~C~~C CH b#CC CH cC4C  HCFeee͜eee e!eii ( 0#K g"#)2x(3xC#*3xHC"+2xC#,3x3x C!.1 x C#/3x C A"#12x03xC#23xHC"32xC#43x3x C!61 x C#73x C "#]2x\3xC#^3xHC"_2x C "#92x83xC#:3xHC";2xC#<3x3x C!>1 x C#?3x C!P1 x1 x )C%R5-x- C!S1 x )C "#I2xH3xC#J3xHC"K2xC#L3x3x C!N1 x C#O3x C!X1 x1 x )C%Z5-x- C![1 x )C "#A2x@3xC#B3xuHC"C2xC#D3x3x C!F1 x C#G3x C!T1 x1 x )C%V5-x- C!W1 x )C ^"#a2x`3xC#b3xZHC"c2x C I"#e2xd3xC#f3xPHC"g2x C 4"#i2xh3xC#j3xGHC"k2x C "#m2xl3xC#n3x=HC"o2x C "#u2xt3xC#v3x4HC"w2x C "#y2xx3xC#z3x*HC"{2x C "#2x3xC#3x!HC"2x C "2#x3x CH "#q2xp3xC#r3xs4!xC HC5eIe_eueeeeԝeee6ee$e8eLeae"32#x23x6Cii  (0#K u"#)2x(3xC#*3xHC"+2xC#,3x3x C!.1 x C#/3x C O#13xH IH1 EH B.8#%[B85cB 5kx)дH 0H ,H )Fb|#|C||C6Cii  (0#K0> "#)2x(3xC#*3xHC"+2x C "-2#x,3x CH 1H H 04#H3 "b~#~C~~C CH "#)2x(3xC#*3xHC"+2xC#,3x3x C!.1 x C#/3x C "#12x03xC#23xrHC"32xC#43x3x C!61 x74 C#x Cc~"~CdH z~~ CaH saH p&BA#X;B:ZK(X# 2rC3hYxi x Cx Cx CYyy Cy Cy CYzz Czz C?C0# 16@H )b~#~C~!C~:HCc& C C C[[ # 1H b|#|C||C C 9*H)B3Jx\CxyCx6CKyCyCyCHK;F5eueeee)eĞeeee#e7eڦe?eSeieeeeleeџeeeeF h i2+"JC02hei%iSi!Hi!hci+ ݎ"XBHu%05&ciBFhh+iki #i+0# )8 H 1N650# )8H締eee7epKFh hH-ch!2H'ci*#ihH4%hh)ch"h H54-@FpF/f0eIelee pGpG pGpG pG pG pG pG#еFXX3!3hWhAh[hhIh{AYA"# X"YA"RBKA!+  0( FнhF!0FDX!,aK X#XC9,C b K, (  F0hF<0m( ;hB݀hBpG@hBnm( ;hB݀hB@hh P1F h+$`a 0aa`kn+ Тh"k 2c43`!a ` KbhXmmKAeeF:h&hB2FNF'YYB #YPK PF) (5FDLKFX "X ;ZCJ[P)D~KP(M-EKX#PJ#P#X+, #XB##OY" MBu3 #[BY" 3B F-#h#22B 3i+03i *i!3hJKHXaX#{yj S#[B0zj~I~ C~ C~ C R C C CRR biB"i B "a ba B B *+i2h  XJ!UJXaXVH#|[|C|C|C ;# B ?h #c 3\Jx CxCxC % ([р! , |Q Cb# Fh+#  X0`PaF)`k```(v(K)Zh 1Y``*a`*(2x# Cp#X*bPZj B2 B( 3#P J3iP t #[B #[B D4DL|dee#B pG\*3 KX(pGhBـhB@hFK%4h,р! ( (aCa `aa b`D``0` Fh&B6% @BFFLLLKXY!(ц#YJ31=J>IX&#B-.BkBvd#:!k0*.0kBv#:!Z0$dB#``cx xCxCxCBv#}+v`dJXB$` F)B9 !(`J`XyB(ѷ $dBF41F# sKX! G((  ! < (.Ѷ2(2xRN+; )BLЪB>#[BYN%YO#XHYaY. + THaYY## - л!MHaXY#) (Z+ )B S+Z+м )ZBI"01R0('7"8h1 #\(!(o#P(GЀ"9h :h)4!x(5+x*0 Cx+2 Cx C# C +p!p pp FB+eKX[B^+[ .W J[X[BN #MF4deVeeF KX# 3Cn<3x#@ 8KBh#+g+ (K4X +X+[B@+3BS 8KXsvB@4"K!X 3)8+h3Bhij#\#\ Bр! ,h(,`#`zhx``B``( F#!8j33")8R (6c|"|C|C|C3"Ck+3+`3V3!rJsK!#qHXyX#[B jJkK!XyX#iH( b|#|C|C|CaK X3@B@ ((#3!8u0SKX B@B@MKX@B@DKX  (AJAK!XyX#BH:#!8):KX@B@1KX  (B#[B)J)K!#+HXyX #28u#a\+3hCj[}+гChhiS``#`C`kh;k`+h3BѠhBѤhChhiS``#`C`kh;k` #+t٠dee|e>eF #X31B!kB" (pKBWCh+#h^hh 3C Н ѳcKX+% #(J3& "!(0#TJ!TKSHXiX3R&vBMJ!MKNHXiX#E ^8U78 F#} + @J!?KAHXiX3*b~#~C~!C~.iCc C C CiiBыB!+J+K#XiX,Hbz#zCz CzC b{#{C{{C6C [iB iBJ!KHXiX#8u'B &vB8#[B (AzF d˲eee?edɳeKF, `j(6 4KPFFKh h[+++>+ 9*K( F#(aEab"#2+9 9( iBуiB҆aa"#9(FHKF8H, #j+A@NhY(z( Ѓh(B(*FY""b02x2x C21 x50 C32xx C41 xC61 x73x C C"aca#j+/iciB*Ѣi#iB&ٔ#\"B h(hKBijiBсjB1bbbbii bKb`b P 9  4yF| B 9:HiSiB iiB @BpG FhBh BC`! 8 (2 +3C;h;``E` {"@CC `aCash[hbCbbbcCcKch2b`aa `F @B 32F 23xx?CK| |C|iC|C:92 vBл#X"KX"K.!K!H"K# @BF 13x+/83x+ 980fB#,3x3xC".2x/4C#xCѲ*J!JHXiX2eBe[eѡdeF5)hKB؂h#ChK" }KB.#3hKXB!+hJKHXaX#&vB0 F!b\#CcT#k cK X533\" +KB?u3#\ + " KB+(?#k BKX K BKJ K'X=+ 3BaK'X#{h+#hAhzih Cjѱi ) zHzJqJ!XaX -Q~~ C~ C~ CS+C-C+C%iFeiaEѫB)bF eJ![J#aHXaXiUJ !ZK[HXaX# qj8Qzz Cz{ Cz CS{+C{-C{+C #YhriBPh3iBJi+ BH7J!>K#XaXh;3B#;i+,KbkXB #c;icc=i8-* 3 #X B# k Bsi2iY! B%H!a hIhBѕB!JK#XaXHHihBѡhBҢ``i+( +HdӴe|ced_eeɵeeKe۶eujj~+~C~C~C j+CCCkCC*C#nBK XB#XBKXBKX;B @ (ЃhBChB^ KH#j~+~C~ C~ Cj+CCCCCC2isi (  8 &5 `Z`` `*akaKZh]`+`j``6hi+8k(>= J!J#HXaXA&vB, anhhh41"BhB7" h% h Khe]KX:ՂB8Њh  |JB3{KX/h=?xK+3BoKXB!"\!CTn ;#3Kh h(2SBZA  h 3B L i  a MKiX a htki*iY#! BOHIJ!NK#XaXiCJ !GKGHXaX# iju hBѡhBҢ``i(٧nj u"2312x03xC323xC232xC343x3x C161 x C373x C "#3\3x3xC2^2x_6C3xCZBSA*iki+3 +ji  Gtdedre|eǜd^ekjh)0x(1 xC*1 x+3x C C #! 1 (?i+j383;x3xC*iki23)2x(3xC3*3xC2+2xC3,3x3x C1.1 x/6 C3x CCZBZAhbhBc`! 8 ?!X70 +#C 3`s``3{"CC3s82asahh2bsbb #TK7cZh11Y`aa`-h23)2x(3xC3*3x0C2+2x2 C3,3xxC3.3x10C2/2xxFC202xC222xaFC030xC242x2x:C767?x?C272x:C)ۨ!g9hhFBaE * ۺB`EؓBBؘHHw~1~?9C~~?C6>C& #6*ikiiN J!K0XaX## &vB#(iii`Y`kj({[**)(2 18B !Тh kh*h*8BR++) 1 )j І#\Fԭi=Z*kkk  !YA CSAjj  !YA  SBZAC#*jC C gh) 1kh*h (kik*{#)@ 1 h h8KB"hChRh*4JhXB+ih:C  i)KB'JhiX`nRh@h<-h Bѕ#XX3K&X y(`i`kj[;+(kii(S``#aai=;ChhS``#`C`Fٷeeǜd<&%F#YBрFcY;cQChhS``#`C`𵅰 (Ai F1C&1lFaFiy`j|hY9!AlhB FHH!iDCxh`A`bF:@9`B&h)h"Y0h(:I:Ha;htijBh9hFjaD" jbjbh3`j+ sijjZB)h@B"3C&3mFFhlDCY:#0Ijj! WF {h0@h"Yj8BIHqijKBj@Cz`h-h] h")0(I HjxhFh`D" %@dҜdkddd0L%B0 x1C@+@[[ X@缎dpM$Bp] s@[[[ X@4缌ds$%B vx.*$C5.0-$ ^0G(-$C# "C#@C#$ @ C7 )( $ px+4B p40B70#E,JRTB)x C 02K@CBXAh%+`h*BThB3, !h)B )C!``h!C`YhB сhY``)$C ``Ah`Z`) C`h``) ChBы`K`3`h)h/B(C``hB Ah`C`)$C ``hU``-#C+`h#``+!ChBќ`\`4`hDh*Dh*<#C+hB3ќ`,54$ ZhBџhBѕhC]``,`h``,j&ChBcѢ`*Vh.4hBgДh,%hBY`hBШC`\` `,"`, h`+ذ!ChBњ`Z`h#*eh"h`4h'<@C4`h,&'C>hBѲ` -C`(`*h-Uh`T`&h'>@C&`r` `h`BЃb` `eh`b`\`-"h\``'=C5`, h8@C `h``(R!ChBJъ`C(`hhBUhC`S`,`h``,&ChBѢ`*h.4h"Th,&h%.B`h$"BC`cb` `*\$C$hP```("Th`S`C`J`F `Dh(h(pGh(@h(pGhBCh!+h+pGhC+ChB h!CB قhBCh+h+pGh(h(Xh(pG𵅰*,*!G(4`$h6h,5`-h6h-4` hBfT"! Grh#`4h%B %B&Y5/?'?#h%`:h*B-"HB#P##5Y*#5"9G(/`}`?h-h/,`e`$h-h,/`)h G+h]`-h+h+.`u`FeHCh;[hiZ"B+CS`#[BihQ:;:j jkBk klmY m!BmIB@kC/9x1@Ix@R72 @\LxI@%?@*Yp3$"Bn%F,@*BЧB Rx@72"RB@CJF?@/9x1@Ix@R72&vB2@C \LxI@?$"B<"@B dx@,=5B=4/@Ca@BLB3ҒJa"`$!9@dB@C,U5`]`B2j`B33accx7@,4m :- ReFBBٴFeDF%V]^U.5BZ5BL v fFe B$FfDuF% ]U56 BѝfE&bFF5" \T2B aF)()QxYpaF)xp3BlBgReFBٴFeDF%V]^U.5BњQxYpx2p3xpaF9F\bxZpbF:F43ZcF[)a  x6 x4 )C19)\4 bFbxZp)&) C C965)[3@$"B4@"CbJ*B$dB@"Cb\LxIr !Ja!`-dKdad𵡰 ! H1DS)!B$& hF!I Z)$9)h`!IPh`S#F&bF `] H Z@[41DS!H[(1)@$ <( @B?e[@@4,((($D4E[40, BbFBFBҌFh`F"@:**в"Bҳ ! D,[,d[oS'm(S0' "'bF$"RB'% BB ӨBҌ @@\ Z%@ %@&vB@"@ R P pVp-J @"Be*P@L Z8 `SBф II ZE5@B0/gF @& @B8 @ ( BfhUhdFDph$D0q"%J %J a"2#J #J`" uRD[6D.p / @Bh'aF@4@&&pfp`N$@"B, f2@ddF%-*h`dddd(i*#!aAc! Ca`aQa!Q`S``bbbcccfedpG @Bp *=x1*:<+8( @B##aj+Jbbcj+Kcb!#jJjG!a- #mB`+;+ # MbKcp+3`/-cjj"G#a#@  Fcc0%i*Cj+ Qk)Ѐj"Gjcji"G a @B $ * xqJBpI[XBnJC  )*y؎B fKBeKeI( X C:x7-`KaJ; xYxx x y Yy y y z Yz z  zF{DX{{gD{ d 3RRRRRRRRR RbD R B 1I ( .I /KB.H(xxTxx[$yTy$yy$zTz$zz${T{${{$2+3 "@B I ( I :x3-P𵑰 Ei,Bh+Ch+<#h +3#`h;i;h{h k k##h+# m!Wq<{BZ$Vm#[B#[BD -"1s @@2113e" =R!fcfB+qK-f23! 2 @! 2 @&a5{c ##`h+[`;a;`{`#cc-؂3&a+e"VKBX"j*`#ii"Wa%#.#`yh) ##`_*O:x3@5-#B>KB"0;K" a)##`a.9##a#j+"RBch"B0 3 ! )+Ka##2@*(K6 3@bj3B%K="@#aba{c33%#`*:x3@5l*:x3@5-#j+^`#iՠi"a%#.#`Fxdd dd d*Ѷ:x3@5-"j*3`#j2 `#ii"a%#.#`"i#@B-ض#j&d+^a#iո%.##`#i[8!lB+,#j+i(ZiiFR B[bF P#iiDaFcD#l#d#l+?##d3#`"i#@B{+1#X"j3\ * i)#ljBZ"d T +B#iiaFcD +J`;a;`{`jcc+ "h;i*Bikk+kj"@j;jGhc(}##`#*:x3@59i"a>#j+<a:#j+a##d3#`"i#[@BE+#X"j3\ * Qj)#ljBZ"d T +B#iivaFcD +s##`#i- ٢i BKK#j+Yb)Z9x2@v5%.!j)"[@b#jc"8axc #*::x3@5#a{c 3#` +)ch+- #3@c`s"+ +":+ѫKd #ceK#e#e="`#*@C@3*:x3@5K"a#*@C@-ٗJ31  J@B ЕK*:x3@5%#d.##`#l+BB+ѽ FcDcD#l#d*Ѣ:x3@5#f3#`m(ѐ8x1@65-YfgI[[Z!831@[=SnBaJ!n+٦#fd#ce##T3!"3p1 -( SK@X[Zf83[Sf##`"ncnF((K81I@fSnaE.l"cmRB@C  0@Bx@B*":x3@5(kѐB+@)3.Ka##`#h+#fd #ce#p3; # #T3 "n (rK(8x3@65 73[[#3@3=cE n01HRBfF4dd`yZy-CyCy 3CЬBBӬB "0[62)(>`BВ pCh!C  @C"%h @.C+3C.@- @3C+CMBci5C@ 5C@+C+ ٣i,C)@ !C@ C+ @B MBcj,C)@ !C@ CKBp   / +0+0+8pGCi!C  @C" @Ch' C?&9@ 6 C3@CJJBЊCiC:@ C3@C-i C9@ C2@C+rBobh C9@ C2@CB"+ !i FeF C :@ *C1@ CBؓBӡh  *C /@ 1@:C C)ؐBؓB :BؓBej'.)1C?.>@1C&- 65@)CB؋Bh&)C65@)C% -*@CB؋B j"C4@ "C(@CRB B @B h&C6%0@ -*@CC"[B7ۙB5"B.bhFgFC0@8C *@C"Bbi8C7@ 8C*@C("B bjC0@ *@CC"B#[B`"(h  C@ C!  @C #[BP4;`(C   #!"(~(x+Ѣ1(t(4#C<`"!(h(h  C@ C!  @C3 3kiFC@ C!  @dDC*cF+[4) @B() @Bo(#sB!0Y( ((-+h3+` v-+h;+`+,#3-$dB#(+ @B# ++!IB kFeB$ 29 (4p(ch  C@ C!  @CB!0 p @Bpi&C6%0@ -C*@C  BbhC0@ C*@C; B`p7 !((  (, $($dB >(, ` h'C"@ ?C;@ C,Ch)C*@ C;@C#` xhC @9C' ?;@CKBj#hF`FCF @ `F;@CC/KB7-TciF`FCF @ `FC;@C)!j F`F CF @ `FC9@ CB0[B! 9(&.0` KBkBF-!j  C @ +C9@ CE bEbF "RB.$""2` /"lp(790(2hCh 2C&67@:C ! @:C:C7@ C @C/`k`hh(C5@ (C @C(C5@ (C @C  @B&'$6?!(($dB hhC0@ C;@C C0@ C9@ CC4h(29((,#!"C#@C#$ @ Cii, (C *@ C@4 C* /!4. 0` @B.$0`𵅰 #4"C+$dB +!8B*(ss]+*@!(x@+!8pD1"(pR( W( 𵅰 +4%, !0(Ѓh C@C" @C0/(B!0:( +`( $dB `Di'&#>C'@>C'$ ?<@ 4C,- #[B+` $1"(0 ( ci$ C$!@ C!  @C+ 3[Ch*C,@ "C @C+00 0z/Ѓh C@C" @C((.3` 8`ki  C@ C!  @C+ 3[ch*C(@ C @C+ 0 0(1"(q7J * J)  * h!C  @C" @C>Fdds IP#B*3 1vF d 3#x%/+2/! B>!2 !4B&3x/+к/!0w<)26B(%mBp !(p𵅰 (- @B B 'BBB.3`8B(ۄB C8"( @Bp (B#) pKp3t!"IB(j p!( B"!$dB B r!8( *! ( 4-D J("CBXAF*ep  (!"(2!(C( p# C H H H2J[BX(HpGFddd}di'C?&8@ 6C3@C '*5٬h#FaF#C#;@ C$ 4@#CB%h!C<@ 2@!CCB(jjh#C<@ 0@#CC[C9@ C2@CBA@Bp($ci C!@ C @C-cj2C0@ C @C! (-Ј#[cap @B h.'+?3C.>@F'? - j3C=@+C .C cF@ 5C9@ C[*&ۡB"؄B ]BEhaF./7C.@>C'- ?=@.CB m  @B (/ѣh&6)C5@)C%- +@C ;C7@ ;C)@ Ch` ;C7@ )@;C C C1@ C+@C`o(.cjr&6)C5@)C%- +@C ;C7@ ;C)@ Chcb ;C7@ )@;C C C1@ C+@C`𵅰(3 FcDi'?C&68@ 3@CC i(0##ahC:@ 3@CCiC:@C 3@C`C:@C 3@Ccb)jh C8@ 1@C CC8@ 3@CCiC:@C 3@C`+j#b𵉰(fh& C6'1@? C;@C#jC2@ C;@CO(D#-ڡh'C?&:@ 6C3@C"a` 3C 3"(`+"j C9@ 2@ CC;C:@ C0@C#b k#j  C1@ C;@ChC2@ C;@Ca0"j C1@ C:@C C1@ C;@C#bF`D #{"h`)h+ C)9@- C5@C`hC:@C 3@CK`𵇰  (R0 3i%C-'*@ ?C;@C#$4!0(5C +@C ;@Cb` C )@C ;@ C#`C +@C ;@C` C )@C ;@ C`iN(B;9"C;@C#? @9C6#i"( $dB𵇰$(9:( C#:(|(#"C1C 1(("#!C " @C"$ @Ct` 3 `C3.2) p :1(_ #2C 2#(r𵅰 (G!(s(AC=!(9(8(٫h!C  @C" @C#C,33"!(3(р#%[2(J(#8c` @Bp1"(pp J() (ۣhB&C60@C  @CIa# p𵇰Fh (](! 0kiC @C" @C(;kj8C9@ C@ C((5!((,ш#[ca!C  @C" @+Ccb-+C-)@ C @Cc` #( ((+j!C  @C" @C(3BB03C0@6 C@CBB @B&1(:1 oK#`C!  @C!  @Cc`#[ca#[ai aF (h!C  @C" @C( @BJ(C0 @BF=dJC0dV(+ h!C  @C" @C F9( B #`F#[B #KFoKXFpGF|}dKFJ##(ICBCAFLecdF*(V%I(('B1 !( B+x//(;x+#(9001(RB  C`8 F!(F dFI'B(+(,8F!(6x/+8x+ 1(B!(i dKFn* KFnH. @BFnn1(hd0F#F(h C@C" @C " F0 @BF# (FY1C:@*C eF+@CQ B#'?FKFCAFFZBSA[B@F$ % $-;@708C7'@6 8C.@0CF x(+ !\CC B/1(d + `(F%mBF b(!(:(o F"CF!`E$dBB:(!$0`p`8e-=u`1 pGKF J! Hfg(KF"fg(KFnFTfe𵅰 )6*4H!$#\C4B3kCtC'c(G(#\\TT3B+B Bإ!(- hh hhhhp$d @, Ѐ#[B @,(CBXAp(CA(#)0&H!u F'eLD#B% !h ф#HXT(#D#B #B"hyh0( 43"h9h0(%$e%.'B(!h)S(= `64p h*hh'"rC#`!#hIBPh[`pp B(Gpp ' h#*$C&1 3sCB)46)#``!l`(` + 3J `p#Fdf&'( K"`=uCE+h+hhh6ch hB##`df kh4B K"`#'gC+hh*Yh(+h 33`df𵍰  ;fh17%}C#h[h*+$h=B #R\Q<ЗB #ah89=KB[chBѣ&nC#hhQO+YhY( h+6+3h. @0"G(# h@h#(#fJ `` #h[h &hov`#h[h+ђ#h[38`BCYh (= h+0+-h0"G( hh#(#hh#h(`#hh+K#h(3`k#hX+Q+YѢhchB4+&nC#hQ'hx`'h` hCh+h+h03`E h0h/ h0"G(!h*1 6; hh#A!h1(* "7 `9#2df𵍰&  BK">`0 hF+ 1"fFG(K"&`vB#kC h"9h#K"&`* df𵉰`Ch`3jFF;aha+`(^%#a}ashiBQK"8i)zik2+SГBRKH #Di#SC4h#h+)#{`k;lh 6k+(лh"Bchx.+k{`;i"P`h{ii+ Ѡh-}h{ai3ahx+йiB\+525#'J @B`F chh, кk! B9i B #k#pk .h`і hh#xF3.=""p hRhx^F, Ѻi401pfF2&piB\,\$pcFxp23c#ddf𵑰{`;m`jFF 8a;`(эK"` GhXчK "h!-hl##p3@;m`+ym8h*;ih+h9i@0#B(0h+;ih+8i (h+0 F l+I5+x +K +I}a#+I,#x4+zhBhB#x+80hBOОB!ChBq #:cC;*vh ;Biٜaia\i:bB?=BHНB$Z "]CEh^VChFhgD=hBнB:SCUCBiiB1bF`m4 $\C``B$ ::B3 6BЀZBٸ $\C`B$B y,2 #SC``ahB``a3KFH"h.%5&#hBF+h# kh # K h  5KA @BKA 926Fee:p3hR B h\h415hkB]A4-45h +2h;[x ZP4 +;[x 2hhRZ`"HnF+de𵇰 #h #0(#`sYx#'hI0('`𵇰 #h'(B #hYx(}(#`p !#X+݄"KPpcUd A\)ѯ]+;Ue]ix ! #X=") (#fUX[+݄"KPdcpd#𵇰X#X# +hZ*`x.*,#**n+`#X3X+hx)! 1 #XZ$8 (iY[\*w?*[*р"X2XZx!^*3+`#+hx*8ф"iKP^*%|*+ H" #T#X+ܢ"ZKP3#T+`! =~ !#X!Z*`x\)]) * &#X(?  &1 "#(X+#B !#X !1 2#X3X!6P 1 ) +hZ*`x)+ K"P! 1+`+ +|KYx** :?)32+`9 ""Sp\ H(+h Z*`xdddd(d#7%"P;PP;P;P x^;YBKAP!x) tx+ѣx+! S !e !a !]#XCBXA> #X!B + 6B(O% s]L]+,УB \B 39]B 4$$B5B+d"RB#\T3*pG#B\T3,x2+\T3*0*+x,5+\T-]B4##p0+0#\\B3*0p#B \\pB3-p  xBpG+0x*pG3p -- xB8B pABx*pG3p0B$ p)p 0\, B2x-00x+ B2x,0 M(.h.903\4++`$ 9 (x+#p0(`Fhfph-((#p0 `(pBًB > \T:p#B \\3pBpP/(J-/B'28<(8  B xCBKFn+(KFnFF"#.) !F!hFKFn+ H KFiFntKF[hHFFdd pG0F F0F#' J#!J#9#JyA 9#iABфB#$ J#!'6OA6oA C FF4ׂCF0 "#$MA]AsBфB؀F0FK%B(d F0F& @BpGhQQ@J J@PP@`pGHF/fK`pGF/f \H#砆   @@ &nC@v!qC8 MCv06&p &^C'WC)`&NC wC01RapCѠ !QC NC02[p+%]C PC03 p*02`"q+AKBy@J#(!=J>KYA#;J!#8J#(!6OA_A#0J!#YA  *HChC "  @@  'yC@  F`FHC? :BC01!p !JC&^C `FHC >FC01[ap !YC 8HC03pcFSC 9YCR0203p#q4~) )𽟆#GGŧ𵝰%:@#@#B" ;SA #;@:#@B;C#:@BO)0 !PBA+њ"+C;3>);#qK @ \CF* eFT3` C/#:@B>'3 C*]"*>+# ;;> #-#>" +Q;#>+ 0"%p$*B!BT)B!p4)B0!!p"a(DBX!Cap4) &6!83C@;d[!0&4+" ++џ-#>  (EBfFp18C@;d[ &!F Bp1Bp18BP * :C@@ $9 C@B]p1Bp2Fd*!O8#(#B)C@#a 'B&#B+BbFp3B*#Bi#BSB "#aFB:x7p3Bp3FneFcD BC #[Bx+ * B;p{B;"p%+B;pxr$SxV++$ +##+#*+1#[B3x.+hsxr09 )]# &0-+0+0; +# !#C2##@##6KC0;2x0; +͖+[B#CsC[20;x08 (C @3xh+(60xx(b(A%(;!X(@B%#;p3xx+OB{p*+Ͳ#[B#z+k+ L+rZ+#[Bl:I@rl+qxl)6L#c8(eYO; !Bp3:*Y#B #*[B;pz $) B8 Bp38+ sxa+9I+_M+3у ##C##8D9i+Fm+@#C!FdH11!@ " \ E]peF)@A\Yp ) *:%2p #Ch !2*Й"p@#C 8)LKBٖKL"sx\36B @#C@#Cx4+ %  Y]  F+ -C .#5p";bF\p"Dp!##C!*hy58`^B8pxX "C!L+E;5C+3 8@"C !>:!*l+Z+h+(h#%+@F,BcFt+z+*h#*h*h #@B A d+d B B` G IFG LD Ie #DFG K M" 'Zu 9= &01ip9 .Flff7 "(`i`#x BxCBXA>7 W(`#x BxCBXA>x0+ Cx J\ 3x+h;0 ` h+ 3 `pG h+3 `+d J\D! B  3W89+0;pG @+d% xB.4`(}C4-" "#` @B:0Bx*Л3B * ` x-+0@B "hIx\ 3k+m+g+рS#`Sxi+2"`#hxB*3#`+d𵇰 O&' xeB-,`09;2!l#46OAp "hMx\ 3k+ m+g+у C CS#`Sxi+2"`#hxB*3#` CpF+dp))JBxK\"BЈx]B 0, `!1p0FB, @B!`+d"!j'8$|C+Bki++kh"jcjiCСh0i jjajjBљB!0/jj !KA$0CCb7'Bki++khj,h"B! iciC"jcjCch+! iai&CF"jcjKA !KACcF`F'7ii1y+}i'}Bܠi*ih*ih0a(ijiB!0ii#10CC7y&'+"(#sC,j,h;Bh(bi*ch+!hbi#CC 6+Bۨi!iiKhHB  +H ELFeeJ#`J!`J`J`KJC`pGFffffffO#6q3q1807r"9mI0h")8cO5*Z) gFdfffffffKhCApGFfqc 9!$(ppq.879lp(q/<48)rir>1phqr*g, 4+ C@ C!  @C2""p.:bppp"qcq44N0<("RB!0(]##p[;cppp4^##p[;cp;p#'Hp#q$O8 <#cq9q7#3p6;p3p33q3sq3q ;sp3q6#p?($C$ @C  @ C6!r29)sis,s4s*t~3p6FɼdԼddB!x)ex))'38+2HL(1CFJM%M *$H"_5d!H!H/-IH #*'N:0F#U/?-IH@#*?'NHKxpHKx/N*0"wU%mBFkdff fd)dfadffffffs6"1KBM#+p# 0S+x 1l0K+x! l1,0BsFcScfD)C++x+Cx+уx+ "KHh#B YBo3921yKB;3x*5*Pћx+=85")+mH")lKlHh"1|jKkMxl78( gKx+р"9(+x+aH)`M"(Z##`]Kh\K)!*3Zx2SHeRK8"0~;3"(+rGL&h.u.j.8#AIBH#`AO)I P#$#wcw3w0KwhR!aCw w"40 "80 I0" " 0"!J 01h0!D#C"IB0 8h1II`fdfcScffffff[dfXf޼d dff5:df*efK `K`K"`K``f\fXfTfdKdH$`BѶ!_K%`^K_Hh'1`$\K]Jh! "ZI YK&$'whgwww!aCw w"(0) ",0" "00 "40?K 280 !B# 3 @Fp(+hkh+"(G,$$dB$F' 9,$H F!H06x2J$'[l;B,HHZhl.BH[l;@ +,H  %e}deddKF.2#` FF(j1ѳhJ{huIB7!02nO! B44:*&hH B!q|3| C  C4- 4:- Bб{F{`F C CYH  B?9 BF*xx C C-- B-#x"C@)@+,9 (!"1]EJh*КB3!" 1NyyC Ccz+#}+c}+!14H*!0+c~"~C C  )=Bb}#}C} C}C %C59 9 (Yb}#}C C}} C C"~d~H$C"$ "C :  h :(G\ff/f/ffefK KB  CJ 0B8pGF/fKFOJ<B C$$ "("I32C$ $ B .sksF"RB*s"js"$ "C  ss.tktF/ff0F"hI"ca{#{ C C*--*C  )`t "t F0IB`s"s `u"u f0F  Cx`rH php  CE"5"p`"%#q @# qbpaqqiFrr%r2 0 "0! W(@rr F0FfF"w$$ #J3  h(:??:C*u2662C 4iuu"$$"C u# *vivvvFf'OF ( DK`('@K$`>H<`:<3`:K"`}6K"`./L#h+ G(Kh+KhB#h"`G3h+3h++%+`eL!h) H!hHKHh+ ;"C# K$h`DK"@$dB`fgfffffffefffeUd#[Dp(0L#D[#[#KIx " jFH!KD0L%"h-C(@%C- (@C p#h"C 0f@g<g1L#D[#[C#@C @ C C @C $J@ Cx%"@ BI2 +H!KDM*hFcFC!  @ C @ C I +h"C 3`V```F0f@g <gFL'D#[#[AKx#@>I B7 " "#@.C"C# @C"B @"R+J`"4"@!!H%!KD# " "#@5C"C# @C"B @"RJ`"4l! @0fgH LKOhD3Kh+Ѐ#[#[#H 3jF!#[DF0gg0Kh8(0U1BGJOV+K!x*J @B"#R"RjF31""RjF#!HzK!xJ @B#"Kh Kh J Khhj g0fggg0fp  BMHhBLL h8(  %6qX GH#|0p DH|0##`=|3#0$h J)h#h%$ J!!u@C veuuu%vevv0#6uKu`K(` K`lF)e_d'gffefgfff } ++" 1%JhB#K"`"O;h+Ѐ"#% 3rrqq" 0t"9o! %u9uur r0uuFFeD1*O) gffNKFhpKN'<0-0h8(FiXdqXX~EO#[+9 8N@I'0$ =Ih Cp BgL#B!;hI  J#[""`J`#/[B[ 7B ؔJKF>>I08|K KBҊH##`I08fK!h- BЁH)##`I0MrK7zN:`)9)!!`hI `tI# `tI3` `('rHrH9hqH_K_I 4hBђeI h* , 3 `YKbIh `cK!`\KhaKBSC"A_JB/# \J;h3`[Kh`MKZIhRFN8h2NKPCh)#TKhTKh+тBFHOHNK"6MI)LHB"B"SGM+hB*`3BBL h `(=Hg!h(hK`hfX:' Ne NX8')e)e)e)e)e)e*e*e*e*e*e%*e-*e5*e=*eE*eM*eU*e\*ec*ej*eq*ex*e*e*e*e*e*e*e*e*e*e(d_e_e^dcdrd^e^e^e_e_e_e$_eD_eWeeWeeWedd)je2jediejejeYiedienie|ieieieieieieieieie6CedFCeddd?CeleCmeee!aaRaYRa Ra=``9``E `} ``4e]hebheghemhewhe|hehe0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-=d4e4e/he'd@d8(Hfne9jeJjeYjeije{jejejejejejejeje keke/ke@keSkefkeoe(@e2@e@@eO@e8e^@ep@e@e@ewkeke~eke]e_e_e aqa5`c6a-``e`m`P`q``!`dbA`mb*a d1``x`u`)```U````k```````y` `-`=`#``````}`i`,e,ee ,e (,e /,e5,e4e<,e ,e F,e M,eU,eҭd`,en,eu,e,e,e,e,e,e     1 !"#$p%p&p'p(p)p*p+p,p-0.0/000105aad HēdHedHedHed IeLd *Ie ܆dUIe ldqIefebq{bzb~b́bdAe e Ae @e Ae @e Ae @e Ae)dReReRedRe@e e@e Ae@eAeAeAe Ae AeAeAeAegegegebe_e_e_e_e_e!`e_e_e`e `e`e `e%`e0`e{`e<`e;`eA`eE`eN`eV`e]`ec`ei`eo`ey`e4e-Me 6Me FMe QMe \Me dMe(epMe?,JeIeIe Ie Ie Ie Je ,Je7JeJeLe 3Le OLe kLe Le LeLe,JeLeLeJeLeLe MeMeKe ?Ke ?KeKeJe,Je Je ,Je sKe Ke JeKe*KeKeKejKeJeJe Je ,Je Je Je JeKe*Ke:KeTKebKe UJe _Je zJe Je IeJeJe,JeaaaaI#c}"c7db^_et heC1ec_e1:QeIh_e&;3e%m_e|w_e~_ewdL3eY3e_3eżde3eo3ei3es3ex3e }3e3e3e3e3erhe3e3e3e3e3e3e3e3e3e3e Re3e 3e3e 3e4e 4e4e4e%4e+4e14e74e<4eJ4eR4eZ4e`4e3e3el4eh4es4ez4e4e4eee-e5-e,eB-e,eS-e,ec-e-es-e-e-e -e-eeewdx2e2e2e4e2e2e2e2e2e2e2e2e2eB1e2e-e3e 3e3e3e 3e$3e,3e;3e?3eee -e-e:e-e2eC3e-e-e-e-e5,e.e.e.e >.eG.e [.ed.e&~.e.e%.e.ewd.e.e.e .e.e/e /e&/e./e:e2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      u-boot*EHCI Host Controller*print_cpuinfo__of_translate_addressfdt_fixup_memory_banksdo_bootvx_fdtraw_accessubi_remove_volusb_setup_descriptordev_get_parent_privdevice_remove__put_mtd_deviceallocate_partitionverify_bbt_descrnand_transfer_oobself_check_aiubi_detach_mtd_devcheck_avubi_open_volumeubi_eba_initubi_self_check_all_ffwl_get_wleubi_dump_flash__mvgbe_mdio_readphy_device_create_ehci_create_int_queueread_blockubifs_read_nodetake_gc_lnumvalidate_sbvalidate_masterubifs_scanubifs_tnc_read_nodedo_kill_orphansreplay_budfs_devreaddev_get_uclass_privadd_mtd_devicecreate_bbtnand_scan_taillate_analysisuif_initcheck_attaching_infoubi_resize_volumeubi_io_read_vid_hdrubi_wl_get_peb__mvgbe_mdio_writedo_readpageubifs_read_node_wbufinit_constants_sbubifs_read_superblockscan_for_masterubifs_scanned_corruptionread_znodeget_cs_sqnumvalidate_refnand_fill_oobvalidate_vid_hdrself_check_in_wl_treeubifs_finddirnand_detectself_check_vid_hdrubi_wl_put_pebubifs_lsself_check_peb_vid_hdrdo_workcrypto_comp_decompressvalidate_ec_hdrubi_do_workerubifs_decompressself_check_ec_hdrself_check_peb_ec_hdrubi_io_writeself_check_not_badubi_io_readdev_get_privcheck_corruptionautoresizeinit_volumesubi_io_read_ec_hdrubi_wl_init__mvgbe_sendubifs_readinit_constants_earlyubifs_read_masterread_pnodeubifs_start_scanubifs_recover_log_lebreplay_log_lebdev_get_uclass_platscan_pebio_initprocess_lvolself_check_volumeubi_io_mark_bad__mvgbe_recvubifs_sizeubifs_check_nodemount_ubifsubifs_read_nnodeubifs_scan_a_nodeubifs_recover_lebubifs_replay_journaldev_get_parent_platearly_erase_pebubi_attach_mtd_devubi_read_volume_tableubi_create_volumeubi_io_is_badubi_wl_scrub_pebubifs_is_mappedfree_orphanscheck_lpt_crctry_read_nodeubifs_recover_master_nodeubifs_validate_entryfdt_find_or_add_subnodedev_get_platubi_early_get_pebvtbl_checkdo_sync_erasewear_leveling_workervalidate_inodecheck_lpt_typeubifs_update_one_lpinsert_old_idxdevice_probevalidate_vid_hdrself_vtbl_checktorture_pebself_check_ecubifs_leb_unmapubifs_igetubifs_change_one_lpadd_to_listnor_erase_preparesync_eraseubifs_calc_lpt_geomnand_waitubi_add_to_avubi_io_sync_eraseerase_workerfilldirnand_select_chipubi_compare_lebsself_check_writeself_check_in_pqubifs_printdirubifs_leb_read%s: Bad cell count for %s drivers/mtd/mtdcore.cBUG at %s:%d/%s()! BUG!(((((AAAAAABBBBBB## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue %s: unlock failed, writes may not work fixed-partitionsread-onlydrivers/mtd/ubi/attach.cmemory allocation error while creating partitions for "%s" mtd: partition "%s" is out of reach -- disabled mtd: partition "%s" extends beyond the end of device "%s" -- size truncated to %#llx drivers/mtd/mtdpart.cWARNING at %s:%d/%s()! mtd: partition "%s" doesn't start on an erase block boundary -- force read-only mtd: partition "%s" doesn't end on an erase block -- force read-only DRAM: sysrstdelaysysrstcmdarch_numberTLB addrirq_spsp start bad length %d < %d ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again Hit any key to stop autoboot: %2d  0%2d *?[\Resetting CPU ... %-12s= 0x%0*lx %-12s= 0x%.*llx Unknown operator '%s' ERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s write %s write: device %d block # %lu, count %lu ... %ld blocks written: %s ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** UBI** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") (none) IDE device %d: Device %d: unknown device changed to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u initcall sequence %p failed at call %p (err=%d) ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryregno-map## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeWrong Ramdisk Image Format ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image ## Loading init Ramdisk from multi component Legacy Image at %08lx ... (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!/memory## WARNING: fixup memory failed! initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... image is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failedbootdelaykernel-offsetkernaddrrootdisk-offsetrootaddr%s.%sUnknown uclass '%s' in label Unknown seq %d for label '%s' part_%xwhole.bootdevMissing bootstd device boot_targetsExpected at most %d bootdevs, but overflowed with boot_target '%s' Scanning bootdev '%s': No more bootdevs ** Booting bootflow '%s' with %s Boot failed (err=%d) Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Automatic boot of image at addr 0x%08lX ... bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again UBIFS error (ubi%d:%d pid %d): %s: invalid crc in LPT node: crc %hx calc %hx UBIFS error (ubi%d:%d pid %d): %s: invalid type (%d) in LPT node type %d bootsecure%*s## Error: Secure boot command not specified ## Error: "%s" returned (code %d) xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected No UBIFS volume mounted! %s - %s Usage: %s - No additional help available. Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\...y Y yes YES %.*s%s%d,%dSunMonTueWedThuFriSatSunMonTueWedThuFriSatunknown node(%lu, %s)inode(%lu, %s, %#08x)(%lu, %s, %u)datatruncate(bad key type: %#08x, %#08x)bad key format %dbootcmd=setenv bootargs ${console} ${mtdparts} ${bootargs_root}; ubi part root; ubifsmount ubi:root; ubifsload 0x800000 ${kernel}; ubifsload 0x1100000 ${initrd}; bootm 0x800000 0x1100000bootdelay=3baudrate=115200loadaddr=0x800000mtdids=nand0=orion_nandmtdparts=mtdparts=orion_nand:1m(uboot),-(root)console=console=ttyS0,115200kernel=/boot/uImageinitrd=/boot/uInitrdbootargs_root=ubi.mtd=1 root=ubi0:root rootfstype=ubifs roRemoving MTD device #%d (%s) with use count %d Error when deleting partition "%s" (%d) %s: null device (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available unbind() method failed on dev '%s' on error path Failed to unbind dev '%s' on error path device '%s' failed to unbind invalid mtd device '%.*s' partition size too small (%llx) no closing ) found in partition name empty partition name no partitions allowed after a fill-up partition unexpected character '%c' at the end of partition out of memory 0x%08llx@0x%08llxunexpected character '%c' at the end of device %s: Device '%s' failed to remove on error path %s: Device '%s' failed to remove, but children are gone %s: Device '%s' failed child_post_remove()U-Boot.armbootp_archbootp_vciDHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d 0123456789ABCDEFEHCI failed: timeout when disabling periodic list , Build: %sextlinux/extlinux.confCore: %d devices, %d uclasses, devicetree: %sVirtual root driver already exists! Virtual root driver does not exist! Some drivers failed to bind bootstdbootstd_drvbootmeth_Some drivers were not found tick-timer(not set)boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit current eth = %s ethaddr%-12s= %s IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s bootcmd## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Flags not supported: enable CONFIG_BOOTFLOW_FULL Out of memory Trying to execute a command out of order ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... filesize## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified bootfilehost:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... no partition id specified partition changed to %s%d,%d List of available devices: %-8s %08x %c%c data abort -n## Resetting to default environment edit: setenv## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed Environment size: %d/%ld bytes ## Error: "%s" not defined usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s fast interrupt request Unable to update property %s:%s, err=%s ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrInvalid data width specifier ### filesystem type is %s uImageJFFS2### %s loading '%s' to 0x%lx ### %s load complete: %d bytes loaded to 0x%lx ### %s LOAD ERROR<%x> for %s! Can't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... PHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x Base Address: 0x%08lx byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Zero length ??? crc32FDXHDX100fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sdelall device %s%d <%s>, # parts = %d #: name size offset mask_flags %2d: %-20s0x%08llx 0x%08llx %d no partitions defined active partition: %s%d,%d - (%s) 0x%08llx @ 0x%08llx could not get current partition info defaults: mtdids : %s mtdparts: addno such device %s defined in mtdids variable too long partition description %s:%s(%s)%sgenerated mtdparts too long, resetting to null delcurrent partition deleted, resetting current to 0 partition %s not found quiet no devices available Device %d bad blocks: %08llx erasescrubclean-y.spread.part.chip NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .oobNo memory for page buffer Error (%d) reading page %08lx Page %08lx dump: OOB: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x .raw.raw.noverifysize adjusted to 0x%llx (%d bad blocks) %s: error at offset %llx, ret %d Unknown nand command suffix '%s'. %zu bytes %s: %s markbadblock 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad biterrToo many pages in one erase block bit position 0 to 7 is allowed Error (%d) nand_erase_nand page %08llx Flip data at 0x%lx with xor 0x%02x (bit=%d) to value=0x%02x Error (%d) write page %08lx Not a NAND device bootdevice ** No boot device ** ** Device %d not available activeeth%d : %s %pM %s ping failed; host %s is not alive host %s is alive prefetch abort The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data resetting ... ** Abort software interrupt ## Executing script at %08lx ubi%d error: %s: cannot erase PEB %d, error %d ubi%d error: %s: cannot erase PEB %d ubi%d error: %s: cannot erase PEB %d (emulated) dynamicstaticSettCleardetachError, no UBI device selected! Device %d: %s, MTD partition %s UBI: MTD device name: "%s" UBI: MTD device size: %llu MiB UBI: physical eraseblock size: %d bytes (%d KiB) UBI: logical eraseblock size: %d bytes UBI: number of good PEBs: %d UBI: number of bad PEBs: %d UBI: smallest flash I/O unit: %d UBI: VID header offset: %d (aligned %d) UBI: data offset: %d UBI: max. allowed volumes: %d UBI: wear-leveling threshold: %d UBI: number of internal volumes: %d UBI: number of user volumes: %d UBI: available PEBs: %d UBI: total number of reserved PEBs: %d UBI: number of PEBs reserved for bad PEB handling: %d UBI: max/mean erase counter: %d/%d -numeric%d: %s Error, no volume name passed create--skipcheckIncorrect type No space left in UBI device! Name too long! verify_mkvol_req failed %d Creating %s volume %s of size %lld removeRemove UBI volume %s (id %d) It's read-only mode Error changing Vol tabel record err=%x UBI: reserve more %d PEBs ubi%d error: %s: cannot remove volume %s, error %d %sing skip_check on volume %s Please see usage %lld bytes written to volume %s UBIFS not mounted, use ubifs mount to mount volume first! UBIFS not mounted, use ubifsmount to mount volume first! ** File not found %s ** undefined instruction starting USB... resetting USB... stopserialstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. storgcc (Debian 12.2.0-14+deb12u1) 12.2.0 GNU ld (GNU Binutils for Debian) 2.40 ubi%d error: %s: work failed with error code %d nc%2u %2u-%2u = %5u %sEHCI fail timeout STS_ASS reset marvell,armada-3700-ehcimarvell,ac5-ehciEHCI fail to reset USB EHCI %x.%02x EHCI failed to shut down host controller. unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error Timeout poll on interrupt endpoint out of buffer pointers (%zu bytes left) RE is too long (code overflow)EHCI failed: timeout when enabling periodic list .callbacks${...}${.flags## Warning: Unknown environment variable access method '%c' ## Warning: Unknown environment variable type '%c' ## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" arocsdxbimautostartbootm_lowbootm_mapsizebootm_sizeenv_buf [%u bytes] too small for value of "%s" mtdpartsbad CRCCannot import environment: errno = %d import failedLoading Environment from %s... readenv() failedFAILED! NANDErasing %s... Writing to %s... %s=%s ## Error: cannot export environment not initialized Failed (%d) Saving Environment to %s... not possible *** Warning - %s, using default environment  ubi%d error: %s: read EC is %lld, should be %d ubi%d error: %s: erase counter overflow at PEB %d, EC %llu ubi%d error: %s: failed to erase PEB %d, error %d ubi%d error: %s: bad physical eraseblock %d detected ubi%d error: %s: no reserved/available physical eraseblocks ubi%d: mark PEB %d as bad ubi%d: %d PEBs left in the reserve %s%daddr%saddr%pM%s.%dethactethrotatenoethprimeeth%d: %s [PRIME]eth%dmacskipethmacskip Error: eth device name "%s" has a space! eth_bootdevDT Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Warning: %s (eth%d) using random MAC address - %pM Error: %s address %pM illegal value Warning: %s failed to set MAC address Failed to iterate over directory %s < ? > %10u %s ** Can not find directory. ** UBIFS error (ubi%d:%d pid %d): %s: cannot read node type %d from LEB %d:%d, error %d Error: FAT sector size mismatch (fs=%hu, dev=%lu) Error: FAT cluster size not set Error: FAT cluster size too big (cs=%u, max=%u) ** Unable to read file %s ** U%02X%02X-%02X%02X#address-cellsfdt_chosen: %s WARNING: could not set bootargs %s. 2023.01+dfsg-2+deb12u3u-boot,versionWARNING: could not set u-boot,version %s. ERROR: - must RESET the board to recover. %s: %s: %s /aliasesetherneteth%daddrlocal-mac-address%s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. linux,phandlefdt_initrd: %s linux,initrd-startlinux,initrd-endWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. #size-cellsrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dokayNo valid device tree binary found at %p No current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster DockStar> no partition number specified unexpected trailing character '%c' no such device %s%d no such partition Jump offset is too bigoutbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02xUBIFS error (ubi%d:%d pid %d): %s: orphan list not empty at unmount missing environment variable: %s ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part %s/ %s %8lld %s %d file(s), %d dir(s) Unknown ArchitectureUnknown CompressionUnknown OSUnknown Image%d Bytes = %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done Cannot find console unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) Error: Invalid FAT entry: 0x%08x %u Warning: MTD name "%s" is not unique! %s%dDevice %s not found! Base path too long (%s%s) Retrieving file: %s Could not initialize timer (err %d) Could not read count from timer (err %d) Error: Bad gzipped data Error: gunzip out of data in header Expected include path: %.*s Couldn't retrieve %s pxe_label_overrideMissing override pxe label: %s Missing default: %s ### ERROR ### Please RESET the board ### CRC32 for %08lx ... %08lx ==> %08lx 0123456789abcdef %0*lxEnv export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it!      XIP %s %s Loading Uncompressing %s Unimplemented compression type %d ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC Unknown image format! %sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x ERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconf - must RESET the board to recover. Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command mtddevnummtddevnameunknown compression methodunknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkinvalid distance too far backinvalid distance codeinvalid literal/length codebaudrateload-environmentNAND: %lu MiB Net: add_node: malloc failed add_node failed! UBIFS error (ubi%d:%d pid %d): %s: old idx added twice! %s=%s%d.%d.%d.%dget_fl_mem: unknown device type, using raw offset! ** ERROR ** %*.*s has dup version =%s %08x Compression: %s frag count: %d compressed sum: %d uncompressed sum: %d load: Failed to find inode has dup version (resolve) = load: Failed to resolve inode structure UNKNOWN COMPRESSION METHOD = load: Failed to read inode ls: Failed to scan jffs2 file structure find_inode failed for name=%.3s %.3s %.2d %.2d:%.2d:%.2d %d %s %8ld %s %s -> Scanning JFFS2 FS: offset %08x already seen, skip . OOPS Cleanmarker has bad size %d != %zu OOPS Padding has bad size %d < %zu Unknown node type: %x len %d offset 0x%x %s: Failed to scan JFFSv2 file structure  done. spi-nandonenandinvalid partition number %d for device %s%d (%s) .dtb./bootmlocalcmdNo kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxkernel_addr_rSkipping %s for failure retrieving kernel ipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s malloc fail (FIT address) fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdt_addrfdtcontroladdr%s: %s list passed to list_sort() too long for efficiency No match for driver '%s' compatibleDevice tree error at node '%s' Error binding driver '%s': %d ERROR: Failed to allocate 0x%lx bytes below 0x%lx. lmb_dump_all: %s.cnt = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes %s ## Total Size = 0x%08x = %d Bytes LZO  Waiting for PHY realtime linkprebootNo CLI availablemarvell,reg-initunknown cmd (%d) at %d ## ERROR: unsupported match method: 0x%02x Cannot add window '%04x:%04x', conflicts with another window %s: %x - %s <--> %s %s is not a known ethernet mdio_register: non unique device name '%s' %llug%llum%lluk%lluEnter choice: PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex NULL device name! MII devices: '%s' Current device: '%s' No such device: %s PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T xwr%08lx: %08x %0lx %04x %02x ? JanFebMarAprMayJunJulAugSepOctNovDecJanFebMarAprMayJunJulAugSepOctNovDecnot same typ %d != %d Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx incorrect device type in %s incorrect device number in %s Minimum partition size 4kiB, %lldB requested No closing ')' found in partition name Empty partition name No partitions allowed after a fill-up Unexpected character '%c' in mtdparts Not enough space to save partitions meta-data Partition size must be a multiple of %d "%s" partitions still in use, can't delete them Wrong mtdparts: %s MTD name too long: %s Could not find a valid device for %s Could not parse device %s Failed parsing MTD partitions from mtdparts! Failed parsing MTD %s OF partitions! nand0=orion_nandmtdparts=orion_nand:1m(uboot),-(root)mtdidsmtdids too long (> %d) mtdparts variable not set, see 'help mtdparts' mtdparts too long (> %d) mtdids: incorrect mtdids: no identifier device id %s%d redefined, please correct mtdids variable could not initialise device list mtdparts=device %s%d redefined, please correct mtdparts variable mtdparts_init: no valid partitions marvell,kirkwood-eth-portfixed-linkfull-duplexFailed to allocate MDIO bus Err..(%s) Dropping packet spread on multiple descriptors Err..(%s) Dropping packet with errors Non-aligned data too large (%d) Err..(%s) in xmit packet phy_connect failed EPTGMKnand_bbt: can't scan flash and build the RAM-based BBT JEDECCould not find valid JEDEC parameter page; aborting UVY ZZ YVUe03f %s:%dblk_partitionCould not find "%s" partition Couldn't find partition %s %s ** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x ** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** Whole Disk## Unknown partition table type %x Partition Map for IDESATAUSBMMCHOSTNVMePV BLOCKVirtIOEFIUNKNOWN device %d -- Partition Type: %s Part Start Sector Num Sectors UUID Type ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s hdusbdmmcsdxx%s%c%dcannot add second partition at offset 0 %s: offset %08llx beyond flash size %08llx %s%d: partition (%s) size too big %s: partitioning exceeds flash size %s%d: partition (%s) start offsetalignment incorrect %s%d: partition (%s) size alignment incorrect %s%d: partition (%s) start offset alignment incorrect ZCould not get PHY for %s: addr %d %s:%d is connected to %s. Reconnecting to %s (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed PHY reset timed out A1A0Z0Error.. %s:Unsupported Kirkwood SoC 88F%04x SoC: Kirkwood 88F%04x_%s fdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%s%llu Hz%s%lu.%ld %cHz%s Boot Extd%3d %-10lu %-10lu %08x-%02x %02x%s%s %u Bytes%s %ciB%subi%d error: %s: self-check failed for PEB %d, EC %d, Protect queue Error parsing config file invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** UBIFS error (ubi%d:%d pid %d): %s: bad data node (block %u, inode %lu) FAT32 FAT12 FAT16 ncipncoutportncinport^%s$Error compiling regex: %s HUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command Invalid OOB size valueubi%d error: %s: bad magic %#08x, must be %#08x ubi%d error: %s: self-check failed for PEB %d ubi%d error: %s: self-check failed for PEB %d, EC %d, RB-tree %p ubi%d error: %s: bad CRC, calculated %#08x, read %#08x ubi%d error: %s: bad VID header magic %#08x at PEB %d, must be %#08x ubi%d error: %s: no volume info, but volume exists ubi%d error: %s: self-check failed for volume %d ubi%d error: %s: bad alignment ubi%d error: %s: alignment is not multiple of min I/O unit ubi%d error: %s: bad data_pad, has to be %lld ubi%d error: %s: update marker and corrupted simultaneously ubi%d error: %s: too large reserved_pebs ubi%d error: %s: bad usable_leb_size, has to be %lld ubi%d error: %s: too long volume name, max is %d ubi%d error: %s: bad name_len %lld ubi%d error: %s: corrupted dynamic volume ubi%d error: %s: bad used_ebs ubi%d error: %s: bad last_eb_bytes ubi%d error: %s: bad used_bytes ubi%d error: %s: bad skip_check ubi%d error: %s: volume info is different Device %d: %s%s: readonly variableWorking FDT set to %lx fdtaddr (effective (T)reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: (%0*x) %0*x USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32Err..(%s) Invalid PHY address %d Err..(%s) Invalid register offset %d Err..(%s) SMI read ready timeout Err..(%s) Invalid phy address Err..(%s) Invalid register offset Error: SMI busy timeout In: No input devices available! Out: No output devices available! Err: No error devices available! RE is too long (data overflow)menutitledefaultpromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedarchitecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIefiEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vloadaddrbootmethu-boot,boot-std/boot/bootmeth_distrou-boot,distro-syslinuxresetPerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]print monitor, compiler and linker versionbootflowBoot flowsscansourcerun script from memorybdinfoprint Board Info structureblkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigureconinfoprint console devices and informationecho args to console[-n] [args..] - echo args to console; -n suppresses newlinebootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structitestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=fsinfoprint information about filesystems[ directory ]load binary file from a filesystem image[ off ] [ filename ] - load binary file from flash bank with offset 'off'load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data loopinfinite loop on address range[.b, .w, .l, .q] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmwmemory write (fill)[.b, .w, .l, .q] address value [count]nmmemory modify (constant address)[.b, .w, .l, .q] addressmmmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]MII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablemdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)define flash/nand partitionschpartchange active partition of a MTD devicepart-id - change active partition (e.g. part-id = nand0,1) of a MTD devicenbootboot from NAND device[partition] | [[[loadAddr] dev] offset]NAND sub-systemNET sub-systemlist - list available devices listpingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoltruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-z-eubiubi commandsdetach - detach ubi from a mtd partition ubi part [part] [offset] - Show or set current partition (with optional VID header offset) ubi info [l[ayout]] - Display volume and ubi layout information ubi list [flags] - print the list of volumes ubi list [flags] - set environment variable to the list of volumes (flags can be -numeric) ubi check volumename - check if volumename exists ubi create[vol] volume [size] [type] [id] [--skipcheck] - create volume name with size ('-' for maximum available size) ubi write[vol] address volume size - Write volume from address with size ubi write.part address volume size [fullsize] - Write part of a volume from address ubi read[vol] address volume [size] - Read volume to address with size ubi remove[vol] volume - Remove volume ubi skipcheck volume on/off - Set or clear skip_check flag in volume header [Legends] volume: character name size: specified in bytes type: s[tatic] or d[ynamic] (default=dynamic)ubifsloadload file from an UBIFS filesystem [bytes] - load file 'filename' to address 'addr'ubifslslist files in a directory[directory] - list files in a 'directory' (default '/')ubifsumountunmount UBIFS volume - unmount current volumeubifsmount - mount 'volume-name' volume1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'imxtractextract a part of a multi-imagerunrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintsaveexistssaveenvsave environment variables to persistent storageshowvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodoneusb_hubusb-hubusb_mass_storageusb-mass-storageBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access fileDOSISOscsisatanvmeefiloadervirtiopvblock/clocks/firmwarerootroot_drivernopsimple_bussimple-bussimple-mfdphy-handlephy-devicesgmii-2500qsgmiirmiirgmiirgmii-idrgmii-rxidrgmii-txidrtbi1000base-x2500base-xrxauisfiinternal25g-auixlaui4caui2caui4NC-SI10gbase-rusxgmiiToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMD/SpansionMacronixEonSanDiskIntelATOUnknownTC58NVG0S3E 1G 3.3V 8-bitTC58NVG2S0F 4G 3.3V 8-bitTC58NVG2S0H 4G 3.3V 8-bitTC58NVG3S0F 8G 3.3V 8-bitTC58NVG5D2 32G 3.3V 8-bitTC58NVG6D2 64G 3.3V 8-bitSDTNRGAMA 64G 3.3V 8-bitH27UBG8T2BTR-BC 32G 3.3V 8-bitH27UCG8T2ATR-BC 64G 3.3V 8-bitH27QCG8T2E5R‐BCF 64G 3.3V 8-bitNAND 4MiB 5V 8-bitNAND 4MiB 3,3V 8-bitNAND 8MiB 3,3V 8-bitNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitNAND 4GiB 1,8V 8-bitNAND 4GiB 3,3V 8-bitNAND 4GiB 1,8V 16-bitNAND 4GiB 3,3V 16-bitNAND 8GiB 1,8V 8-bitNAND 8GiB 3,3V 8-bitNAND 8GiB 1,8V 16-bitNAND 8GiB 3,3V 16-bitNAND 16GiB 1,8V 8-bitNAND 16GiB 3,3V 8-bitNAND 16GiB 1,8V 16-bitNAND 16GiB 3,3V 16-bitNAND 32GiB 1,8V 8-bitNAND 32GiB 3,3V 8-bitNAND 32GiB 1,8V 16-bitNAND 32GiB 3,3V 16-bitNAND 64GiB 1,8V 8-bitNAND 64GiB 3,3V 8-bitNAND 64GiB 1,8V 16-bitNAND 64GiB 3,3V 16-bitmvgbemarvell,kirkwood-ethGeneric PHYMarvell 88E1680Marvell 88E1310Marvell 88E151xMarvell 88E1240Marvell 88E1149SMarvell 88E1145Marvell 88E1121RMarvell 88E1118RMarvell 88E1118Marvell 88E1111SMarvell 88E1011Sorion_timermarvell,orion-timermarvell,armada-370-timermarvell,armada-xp-timerusb_dev_genericu-boot,bootdev-usbehci_mvebumarvell,orion-ehcifatext4ubifsunsupportedNONEZERORTIMERUBINMIPSCOPYDYNRUBINZLIBzlibdeflatenot categorizeddirtyfreeemptyfreeable0 (GC)1 (base)2 (data)commit restingbackground commit requestedcommit requiredBACKGROUND commit runningcommit running and requiredbroken commitinode nodedata nodedirentry nodexentry nodetruncate nodepadding nodesuperblock nodemaster nodereference nodeindexing nodecommit start nodeorphan nodeno node groupin node grouplast of node groupdirentryxentryFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGSseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcjedec,spi-norsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspallwinner,sun4i-a10-nandaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-initu-boot,bootdev-ethnvlansyntax error FATFAT32blksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) fromTFTP %s server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx Retry count exceeded %s; starting again clock-frequencyCould not get ECC infoHUSH_VERSION0.01ubi%d error: %s: two LEBs with same sequence number %llu ubi%d error: %s: 'ubi_io_read_ec_hdr()' returned unknown code %d ubi%d error: %s: this UBI version is %d, image version is %d ubi%d error: %s: erase counter overflow, max is %d ubi%d error: %s: bad image sequence number %d in PEB %d, expected %d ubi%d error: %s: PEB %d contains corrupted VID header, and the data does not contain all 0xFF ubi%d error: %s: this may be a non-UBI PEB or a severe VID header corruption which requires manual inspection hexdump of PEB %d offset %d, length %dubi%d error: %s: 'ubi_io_read_vid_hdr()' returned unknown code %d ubi%d: "delete" compatible internal volume %d:%d found, will remove it ubi%d: read-only compatible internal volume %d:%d found, switch to read-only mode ubi%d: "preserve" compatible internal volume %d:%d found ubi%d error: %s: incompatible internal volume %d:%d found ubi%d: scanning is finished ubi%d error: %s: %d PEBs are corrupted and preserved Corrupted PEBs are:ubi%d error: %s: too many corrupted PEBs, refusing ubi%d: empty MTD device detected ubi%d error: %s: MTD device is not UBI-formatted and possibly contains non-UBI data - refusing it ubi%d error: %s: bad is_empty flag ubi%d error: %s: negative values ubi%d error: %s: bad vol_id ubi%d error: %s: highest_vol_id is %d, but vol_id %d is there ubi%d error: %s: bad vol_type ubi%d error: %s: bad data_pad ubi%d error: %s: bad ai->min_ec (%d), %d found ubi%d error: %s: bad ai->max_ec (%d), %d found ubi%d error: %s: too high PEB number %d, total PEBs %d ubi%d error: %s: bad lnum or used_ebs ubi%d error: %s: non-zero used_ebs ubi%d error: %s: incorrect highest_lnum or lnum ubi%d error: %s: bad leb_count, %d objects in the tree ubi%d error: %s: bad highest_lnum ubi%d error: %s: bad ai->vols_found %d, should be %d ubi%d error: %s: VID header is not OK (%d) ubi%d error: %s: bad sqnum %llu ubi%d error: %s: bad vol_id %d ubi%d error: %s: bad compat %d ubi%d error: %s: bad lnum %d ubi%d error: %s: bad used_ebs %d ubi%d error: %s: bad data_pad %d ubi%d error: %s: bad highest_lnum %d ubi%d error: %s: bad last_data_size %d ubi%d error: %s: PEB %d is not referred ubi%d error: %s: bad attaching information about LEB %d ubi%d error: %s: bad attaching information about volume %d ubi%d error: %s: mtd%d is already attached to ubi%d ubi%d error: %s: refuse attaching mtd%d - it is already emulated on top of UBI ubi%d error: %s: only %d UBI devices may be created ubi%d error: %s: already exists ubi%d: attaching mtd%d ubi%d error: %s: multiple regions, not implemented ubi%d error: %s: min. I/O unit (%d) is not power of 2 ubi%d error: %s: bad write buffer size %d for %d min. I/O unit ubi%d error: %s: unaligned VID header shift %d ubi%d error: %s: bad VID header (%d) or data offsets (%d) ubi%d: MTD device %d is write-protected, attach in read-only mode ubi%d error: %s: failed to attach mtd%d, error %d ubi%d error: %s: cannot clean auto-resize flag for volume %d ubi%d error: %s: cannot auto-resize volume %d ubi%d: volume %d ("%s") re-sized from %d to %d LEBs ubi%dubi%d error: %s: cannot add volume %d ubi%d error: %s: cannot initialize UBI %s, error %d ubi%d error: %s: cannot spawn "%s", error %d ubi%d: attached mtd%d (name "%s", size %llu MiB) ubi%d: PEB size: %d bytes (%d KiB), LEB size: %d bytes ubi%d: min./max. I/O unit sizes: %d/%d, sub-page size %d ubi%d: VID header offset: %d (aligned %d), data offset: %d ubi%d: good PEBs: %d, bad PEBs: %d, corrupted PEBs: %d ubi%d: user volume: %d, internal volumes: %d, max. volumes count: %d ubi%d: max/mean erase counter: %d/%d, WL threshold: %d, image sequence number: %u ubi%d: available PEBs: %d, total reserved PEBs: %d, PEBs reserved for bad PEB handling: %d ubi%d error: %s: self-check failed drivers/mtd/ubi/vtbl.cubi%d error: %s: unsupported on-flash UBI format ubi%d error: %s: VID of PEB %d header is bad, but it was OK earlier, err %d ubi%d error: %s: volume %d already exists ubi%d error: %s: volume "%s" exists (ID %d) ubi%d error: %s: not enough PEBs, only %d available ubi%d error: %s: cannot create volume %d, error %d ubi%d error: %s: out of volume IDs ubi%d error: %s: %s reference count %d, destroy anyway ubi%d: detaching mtd%d ubi%d: mtd%d is detached ubi%d error: %s: %s: work failed with error code %d eraseblock attaching information dump: ec %d pnum %d lnum %d scrub %d sqnum %llu Volume attaching information dump: vol_id %d highest_lnum %d leb_count %d compat %d vol_type %d used_ebs %d last_data_size %d data_pad %d Erase counter header dump: magic %#08x version %d ec %llu vid_hdr_offset %d data_offset %d image_seq %d hdr_crc %#08x erase counter header hexdump: ubi%d: dumping %d bytes of data from PEB %d, offset %d Volume identifier header dump: magic %08x version %d vol_type %d copy_flag %d compat %d vol_id %d lnum %d data_size %d used_ebs %d data_pad %d sqnum %llu hdr_crc %08x Volume identifier header hexdump: Volume information dump: vol_id %d reserved_pebs %d alignment %d data_pad %d vol_type %d name_len %d usable_leb_size %d used_ebs %d used_bytes %lld last_eb_bytes %d corrupted %d upd_marker %d skip_check %d name %s 1st 5 characters of name: %c%c%c%c%c Volume table record %d dump: name NULL crc %#08x ubi%d error: %s: erase counter overflow at PEB %d, EC %d ubi%d error: %s: no free eraseblocks ubi%d error: %s: no enough physical eraseblocks (%d, need %d) ubi%d: force data checking ubi%d: recover PEB %d, move data to PEB %d ubi%d: data was successfully recovered ubi%d: try again ubi%d: try another PEB Volume %s not found! UBI error: too many MTD devices, maximum is %d UBI error: cannot open mtd %s, error %d UBI error: cannot attach mtd%d UBI error: cannot initialize UBI, error %d ubi%d error: %s: error %d while checking if PEB %d is bad ubi%d error: %s: read-only mode ubi%d error: %s: cannot mark PEB %d bad, error %d (ECC error)ubi%d: fixable bit-flip detected at PEB %d ubi%d error: %s: error %d%s while reading %d bytes from PEB %d:%d, read %zd bytes ubi%d error: %s: validation failed for PEB %d ubi%d error: %s: cannot invalidate PEB %d, write returned %d ubi%d: run torture test for PEB %d ubi%d error: %s: erased PEB %d, but a non-0xFF byte found ubi%d error: %s: pattern %x checking failed for PEB %d ubi%d: PEB %d passed torture test, do not mark it as bad ubi%d error: %s: read problems on freshly erased PEB %d, must be bad ubi%d error: %s: bad VID header CRC at PEB %d, calculated %#08x, read %#08x ubi%d error: %s: cannot write %d bytes to PEB %d:%d (emulated) ubi%d error: %s: cannot allocate memory to check writes ubi%d error: %s: self-check failed for PEB %d:%d, len %d ubi%d: data differ at position %d ubi%d: hex dump of the original buffer from %d to %d ubi%d: hex dump of the read buffer from %d to %d ubi%d error: %s: error %d while writing %d bytes to PEB %d:%d, written %zd bytes UBI error: too many parameters, max. is %d UBI error: parameter "%s" is too long, max. is %d UBI error: too many arguments at "%s" UBI error: incorrect bytes count: "%s" UBI error: bad value for max_beb_per1024 parameter: %sUBI error: bad value for ubi_num parameter: %subi%d error: %s: cannot open device %d, volume %d, error %d UBI partition '%s' already selected Partition %s not found! %s,%sUBI init error %d Please check, if the correct MTD partition is used (size big enough?) ubi%d error: %s: the layout volume was not found ubi%d error: %s: too many LEBs (%d) in layout volume ubi%d: volume table was restored ubi%d error: %s: both volume tables are corrupted ubi%d error: %s: more than one auto-resize volume (%d and %d) layout volumeubi%d error: %s: not enough PEBs, required %d, available %d ubi%d error: %s: %d PEBs are corrupted and not used ubi%d error: %s: found %d volumes while attaching, maximum is %d + %d ubi%d error: %s: too large volume ID %d found ubi%d: finish volume %d removal ubi%d error: %s: bad attaching information, error %d ubi%d error: %s: too small size %d, %d LEBs contain data ubi%d error: %s: not enough PEBs: requested %d, available %d ubi%d error: %s: cannot allocate memory to check for 0xFFs ubi%d error: %s: err %d while reading %d bytes from PEB %d:%d, read %zd bytes ubi%d error: %s: flash region at PEB %d:%d, length %d does not contain all 0xFF bytes ubi%d: hex dump of the %d-%d region ubi%d: reserved more %d PEBs for bad PEB handling size > volume size! Aborting! Cannot start volume update Couldnt or partially wrote data updatingdamaged volume, update marker is setNo size specified -> Using max size (%lld) Read %zu bytes from volume %s to %p read from corrupted volume %dNO MEM read err %x ubi%d error: %s: new PEB %d does not contain all 0xFF bytes ubi_bgt%ddubi%d error: %s: PEB %d not found ubi%d: schedule PEB %d for scrubbing UBIFS error (ubi%d:%d pid %d): %s: too few LPT LEBs UBIFS error (ubi%d:%d pid %d): %s: LPT ltab too big UBIFS error (ubi%d:%d pid %d): %s: cannot change properties of LEB %d, error %d UBIFS error (ubi%d:%d pid %d): %s: bad magic %#08x, expected %#08x UBIFS error (ubi%d:%d pid %d): %s: bad node type %d UBIFS error (ubi%d:%d pid %d): %s: bad CRC: calculated %#08x, read %#08x UBIFS error (ubi%d:%d pid %d): %s: bad node length %d UBIFS error (ubi%d:%d pid %d): %s: bad node at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: invalid compression type %d UBIFS error (ubi%d:%d pid %d): %s: %s compression is not compiled in UBIFS error (ubi%d:%d pid %d): %s: cannot decompress %d bytes, compressor %s, error %d unknownR5unknown/invalid name hashsimpleunknown/invalid formatNot a node, first %zu bytes: magic %#x crc %#x node_type %d (%s) group_type %d (%s) sqnum %llu len %u pad_len %u key_hash %d (%s) key_fmt %d (%s) flags %#x big_lpt %u space_fixup %u min_io_size %u leb_size %u leb_cnt %u max_leb_cnt %u max_bud_bytes %llu log_lebs %u lpt_lebs %u orph_lebs %u jhead_cnt %u fanout %u lsave_cnt %u default_compr %u rp_size %llu rp_uid %u rp_gid %u fmt_version %u time_gran %u UUID %pUB highest_inum %llu commit number %llu log_lnum %u root_lnum %u root_offs %u root_len %u gc_lnum %u ihead_lnum %u ihead_offs %u index_size %llu lpt_lnum %u lpt_offs %u nhead_lnum %u nhead_offs %u ltab_lnum %u ltab_offs %u lsave_lnum %u lsave_offs %u lscan_lnum %u empty_lebs %u idx_lebs %u total_free %llu total_dirty %llu total_used %llu total_dead %llu total_dark %llu lnum %u offs %u jhead %u key %s creat_sqnum %llu size %llu nlink %u atime %lld.%u mtime %lld.%u ctime %lld.%u uid %u gid %u mode %u xattr_cnt %u xattr_size %u xattr_names %u compr_type %#x data len %u inum %llu type %d nlen %d name (bad name length, not printing, bad or corrupted node) size %u compr_typ %d data size %d data: inum %u old_size %llu new_size %llu child_cnt %d level %d Branches: %d: LEB %d:%d len %d key %s last node flag %llu %d orphan inode numbers: ino %llu node type %d was not recognized (pid %d) dumping pnode: address %zx parent %zx cnext %zx flags %lu iip %d level %d num %d %d: free %d dirty %d flags %d lnum %d znode %p, LEB %d:%d len %d parent %p iip %d level %d child_cnt %d flags %lx zbranches: %d: znode %p LEB %d:%d len %d key %s %d: LNC %p LEB %d:%d len %d key %s %s: Error, no memory for malloc! Symlink recursion, aborting %s/%sUBIFS error (ubi%d:%d pid %d): %s: error %d reading pnode at %d:%d UBIFS error (ubi%d:%d pid %d): %s: calc num: %d UBIFS error (ubi%d:%d pid %d): %s: inode is too large (%lld) UBIFS error (ubi%d:%d pid %d): %s: unknown compression type %d UBIFS error (ubi%d:%d pid %d): %s: inode %lu validation failed, error %d UBIFS error (ubi%d:%d pid %d): %s: failed to read inode %lu, error %d UBIFS error (ubi%d:%d pid %d): %s: ubi_is_mapped failed for LEB %d, error %d UBIFS error (ubi%d:%d pid %d): %s: reading %d bytes from LEB %d:%d failed, error %d UBIFS error (ubi%d:%d pid %d): %s: unmap LEB %d failed, error %d Loading file '%s' to addr 0x%08x... Done UBIFS error (ubi%d:%d pid %d): %s: current fanout %d, branch count %d UBIFS error (ubi%d:%d pid %d): %s: max levels %d, znode level %d UBIFS error (ubi%d:%d pid %d): %s: bad branch %d UBIFS error (ubi%d:%d pid %d): %s: bad key type at slot %d: %d UBIFS error (ubi%d:%d pid %d): %s: bad target node (type %d) length (%d) UBIFS error (ubi%d:%d pid %d): %s: have to be %d UBIFS error (ubi%d:%d pid %d): %s: have to be in range of %d-%d UBIFS error (ubi%d:%d pid %d): %s: bad key order (keys %d and %d) UBIFS error (ubi%d:%d pid %d): %s: keys %d and %d are not hashed but equivalent UBIFS error (ubi%d:%d pid %d): %s: bad indexing node at LEB %d:%d, error %d other %s: Error in ubifs_iget(), ino=%lld ret=%p! %9lld %24.24s UBIFS error (ubi%d:%d pid %d): %s: cannot find next direntry, error %d UBI volumeUBIFS error (pid: %d): cannot open "%s", error %d UBIFS: only ro mode in U-Boot allowed. UBIFS error (ubi%d:%d pid %d): %s: too small LEBs (%d bytes), min. is %d bytes UBIFS error (ubi%d:%d pid %d): %s: too few LEBs (%d), min. is %d UBIFS error (ubi%d:%d pid %d): %s: bad min. I/O size %d UBIFS error (ubi%d:%d pid %d): %s: bad write buffer size %d for %d min. I/O unit UBIFS error (ubi%d:%d pid %d): %s: can't format empty UBI volume: read-only %s UBIFS error (ubi%d:%d pid %d): %s: cannot mount read-write - read-only media UBIFS error (ubi%d:%d pid %d): %s: 'compressor "%s" is not compiled in UBIFS error (ubi%d:%d pid %d): %s: too small LEB size %d, at least %d needed UBIFS error (ubi%d:%d pid %d): %s: too small log %d LEBs, required min. %d LEBs ubifs_bgt%d_%dUBIFS error (ubi%d:%d pid %d): %s: no LEB for GC UBIFS error (ubi%d:%d pid %d): %s: invalid node type %d in orphan area at %d:%d UBIFS error (ubi%d:%d pid %d): %s: out of order commit number %llu in orphan node at %d:%d ubifs: Error offset must be a multiple of %d ubifs: Error offset (%lld) > file-size (%lld) %s: Error, malloc fails! UBIFS error (ubi%d:%d pid %d): %s: cannot read page %lu of inode %lu, error %d Error reading file '%s' UBIFS error (ubi%d:%d pid %d): %s: unexpected node type %d master LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad leb_cnt on master node UBIFS error (ubi%d:%d pid %d): %s: bad master node at offset %d error %d UBIFS error (ubi%d:%d pid %d): %s: error %d reading nnode at %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad node type (%d but expected %d) UBIFS error (ubi%d:%d pid %d): %s: expected node type %d UBIFS error (ubi%d:%d pid %d): %s: bad node length %d, expected %d UBIFS error (ubi%d:%d pid %d): %s: bad node at LEB %d:%d, LEB mapping status %d No UBIFS filesystem found! UBIFS error (ubi%d:%d pid %d): %s: on-flash format version is w%d/r%d, but software only supports up to version w%d/r%d UBIFS error (ubi%d:%d pid %d): %s: on-flash format version %d is not supported UBIFS error (ubi%d:%d pid %d): %s: unsupported key format UBIFS error (ubi%d:%d pid %d): %s: min. I/O unit mismatch: %d in superblock, %d real UBIFS error (ubi%d:%d pid %d): %s: LEB size mismatch: %d in superblock, %d real UBIFS error (ubi%d:%d pid %d): %s: bad LEB count: %d in superblock, %d on UBI volume, %d minimum required UBIFS error (ubi%d:%d pid %d): %s: max. LEB count %d less than LEB count %d UBIFS error (ubi%d:%d pid %d): %s: too small journal (%lld bytes), must be at least %lld bytes UBIFS error (ubi%d:%d pid %d): %s: too large journal size (%lld bytes), only %lld bytes available in the main area UBIFS error (ubi%d:%d pid %d): %s: bad superblock, error %d UBIFS error (ubi%d:%d pid %d): %s: unexpected return value %d UBIFS error (ubi%d:%d pid %d): %s: corrupt empty space LEB %d:%d, corruption starts at %d UBIFS error (ubi%d:%d pid %d): %s: corruption %d UBIFS error (ubi%d:%d pid %d): %s: Not a valid node UBIFS error (ubi%d:%d pid %d): %s: Node a CS node, type is %d UBIFS error (ubi%d:%d pid %d): %s: CS node cmt_no %llu != current cmt_no %llu UBIFS error (ubi%d:%d pid %d): %s: failed to get CS sqnum UBIFS error (ubi%d:%d pid %d): %s: unrecoverable log corruption in LEB %d UBIFS error (ubi%d:%d pid %d): %s: failed to recover master node UBIFS error (ubi%d:%d pid %d): %s: dumping first master node UBIFS error (ubi%d:%d pid %d): %s: dumping second master node UBIFS error (ubi%d:%d pid %d): %s: bad index head LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: first log node at LEB %d:%d is not CS node UBIFS error (ubi%d:%d pid %d): %s: first CS node at LEB %d:%d has wrong commit number %llu expected %llu UBIFS error (ubi%d:%d pid %d): %s: first node is not at zero offset UBIFS error (ubi%d:%d pid %d): %s: file system's life ended UBIFS error (ubi%d:%d pid %d): %s: bad sqnum %llu, commit sqnum %llu UBIFS error (ubi%d:%d pid %d): %s: bud at LEB %d:%d was already referred UBIFS error (ubi%d:%d pid %d): %s: unexpected node in log UBIFS error (ubi%d:%d pid %d): %s: log error detected while replaying the log at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: no UBIFS nodes found at the log head LEB %d:%d, possibly corrupted UBIFS error (ubi%d:%d pid %d): %s: bad truncation node UBIFS error (ubi%d:%d pid %d): %s: unexpected node type %d in bud LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad node is at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: garbage UBIFS error (ubi%d:%d pid %d): %s: bad node UBIFS error (ubi%d:%d pid %d): %s: unknown UBIFS error (ubi%d:%d pid %d): %s: empty space starts at non-aligned offset %d UBIFS error (ubi%d:%d pid %d): %s: corrupt empty space at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: LEB %d scanning failed UBIFS error (ubi%d:%d pid %d): %s: LEB %d scanning failed, error %d UBIFS error (ubi%d:%d pid %d): %s: bad pad node at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad padding length %d - %d UBIFS error (ubi%d:%d pid %d): %s: corruption at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: first %d bytes from LEB %d:%d %s: Error reading inode %ld! UBIFS error (ubi%d:%d pid %d): %s: cannot read %d bytes from LEB %d:%d, error %d UBIFS error (ubi%d:%d pid %d): %s: bad key in node at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: cannot update properties of LEB %d, error %d directory entryextended attribute entryUBIFS error (ubi%d:%d pid %d): %s: bad %s node UBIFS error (ubi%d:%d pid %d): %s: bad key type %d Error reading superblock on volume '%s' errno=%d! Unmounting UBIFS volume %s! ( w usb,device-classusb,interface-classHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlySelf Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d String: "%s"Error: Cannot find high speed parent of usb-1 device See InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudiounable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times cannot reset port %i!? Bus %s: Port not available. probe failed, error %d No working controllers found lun%dusb_storage_blkusb_bootdevscanning bus %s for devices... No USB Device found %d USB Device(s) found generic_bus_%x_dev_%xusb_dev_generic_drvusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX selecting invalid interface %d%s: invalid max packet size Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) 12 Mb/s+- %s (%s, %dmA) %s %s %s %s Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ubi%d error: %s: node with incompatible UBI version found: this UBI version is %d, image version is %d ubi%d error: %s: bad VID header offset %d, expected %d ubi%d error: %s: bad data offset %d, expected %d ubi%d error: %s: bad erase counter %lld ubi%d error: %s: bad EC header ubi%d error: %s: inconsistent vol_id ubi%d error: %s: inconsistent vol_type ubi%d error: %s: inconsistent used_ebs ubi%d error: %s: inconsistent data_pad ubi%d error: %s: inconsistent VID header at PEB %d ubi%d error: %s: bad copy_flag ubi%d error: %s: bad compat ubi%d error: %s: zero used_ebs ubi%d error: %s: zero data_size ubi%d error: %s: bad data_size ubi%d error: %s: too high lnum ubi%d error: %s: non-zero data CRC ubi%d error: %s: non-zero data_size ubi%d error: %s: zero data_size of copy ubi%d error: %s: bad VID header drivers/mtd/nand/raw/nand_bbt.cU-Boot 2023.01+dfsg-2+deb12u3 (Jun 22 2026 - 08:38:07 +0000) Seagate FreeAgent DockStarubi%d error: %s: bad CRC at record %u: %#08x, not %#08x ubi%d error: %s: bad data_pad, has to be %d ubi%d error: %s: too large reserved_pebs %d, good PEBs %d ubi%d error: %s: volumes %d and %d have the same name "%s" ubi%d error: %s: volume table check failed: record %d, error %d ubi%d error: %s: error %d while reading VID header from PEB %d ubi%d error: %s: too many erroneous eraseblocks (%d) ubi%d: scrubbed PEB %d (LEB %d:%d), data moved to PEB %d ubi%d error: %s: error %d while moving PEB %d to PEB %d ubi%d error: %s: error %d while moving PEB %d (LEB %d:%d) to PEB %d No space left to write bad block table ERROR : xmalloc failed ERROR : xrealloc failed Unknown errorloadxy_timeout1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d C` E`D`A`C`[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OSde@aee7ee@aee&/ee@aeeҭde@a ee!7ee@a@ee)7ee@aee-7ee@aee27ee@aeeee@aee:8ee@aP`eescan - boot first available bootflow [addr] - run script starting at addr - A valid image header must be present%9e{@a%T`ee*9e{@aS`ee /addr [-c] [-q] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.@ - list partition table mtdparts delall - delete all partitions mtdparts del part-id - delete partition (e.g. part-id = nand0,1) mtdparts add [@] [] [ro] - add partition mtdparts default - reset partition table to defaults ----- this command uses three environment variables: 'partition' - keeps current partition identifier partition := := ,part_num 'mtdids' - linux kernel mtd device id <-> u-boot device id mapping mtdids=[,,...] := = := 'nand'|'nor'|'onenand'|'spi-nand' := mtd device number, 0... := unique device tag used by linux kernel to find mtd device (mtd->name) 'mtdparts' - partition list mtdparts=mtdparts=[;...] := :[,...] := unique device tag used by linux kernel to find mtd device (mtd->name) := [@][][] := standard linux memsize OR '-' to denote all remaining space := partition start offset within the device := '(' NAME ')' := when set to 'ro' makes partition read-only (not used, passed to kernel)info - show available NAND devices nand device [dev] - show or set current device nand read - addr off|partition size nand write - addr off|partition size read/write 'size' bytes starting at offset 'off' to/from memory address 'addr', skipping bad blocks. nand read.raw - addr off|partition [count] nand write.raw[.noverify] - addr off|partition [count] Use read.raw/write.raw to avoid ECC and access the flash as-is. nand erase[.spread] [clean] off size - erase 'size' bytes from offset 'off' With '.spread', erase enough for given file size, otherwise, 'size' includes skipped bad blocks. nand erase.part [clean] partition - erase entire mtd partition' nand erase.chip [clean] - erase entire chip' nand bad - show bad blocks nand dump[.oob] off - dump page nand scrub [-y] off size | scrub.part partition | scrub.chip really clean NAND erasing bad blocks (UNSAFE) nand markbad off [...] - mark bad block(s) at offset (UNSAFE) nand biterr off bit - make a bit error at offset and bit position (UNSAFE)Qe{@ae`eeaddr part [dest] - extract from legacy image at and copy to default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] ,e{@a`eew]e {@a%`ee~]e{@a`ee]e{@a`ee]e{@a`ee]e e@ae`ee<[e e@aQ9aee]e{@a`eed {@a`ee]e{@a`ee1es^e8x^e}^e <3e^e^e ^e ]e ^e ^e ```````` ```M`` `u8a1b`m```A```8a]`]+a` ```eeeeeeeeeeeeee e eeeee$e$e,e,e4e4edeVdendededededededeeeee/eeDeeZeepee ee ee ee ee@ee:@ee*@ feJ@ fe6fe<Lfe,cfeLzfefe>fe.feN0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N()*+,-./0123456789:;<=>?&*f*ffe bbنbfeA%bbنb geAib%bنbge Ab%bنbbb+ge0A b%bنb;ge Ab%bنbLge Abkbنb\ge AŖbbنbmge@A-bAbنb~geA-bAbنbge Ab%bنbge` Ab%bنbeserial0bbEb1bbbbeb9b1bbɫbab]b b)  @ @  bBhe9bbbEbb-bbbbabbKb3b?bFhebibbbb-bbbbKb3b?bKheccccc-bIcEbbKb3b?bQhebbb9bb-bbEbbKb3b?bhehec-e-e%c-eeKhe*c"c/fAd fDee@as`!De=De]8ee@a=R`d8ee8e{@aS`8e8e-ee@a9L`6ee6ee@a9L`6ee :e {@a U`:e6:e&8e P`@a/8eeO`%e e@aK`6eTe Ree@aѫ`ReyQe9e{@aU`9e9ePe{@am`Pe=PeEee@au`EeEe49ee@aMT`<9eeQee@ax`8EeDEe~de@a-t`DeDeQee@a`QeyQed e@aT`b9ew9e ]e{@a`]e-]e5Dda8eTd}db d bo9eI*a}d)=ddEbeDdeDd4e]3`eDdyneQdeDdzne5Qd1d)bbbV_eVaWaTaZ_e@ZaQZa=Zaei[ad7`u;` 4edoad':d%>d;d:d_eGLeM`_e_edUxa geqbeb hetoaEbb@ $heu^evoa abD@ $^e>H;f}d;f,d `$`(`,`0`4`8`(`,`0`````````x`|` ` ` ` ` `$ `\ `` `d `h `l `p `t `x `| ` ` ` ` ` ` ` ` ` ` ``,`P`t```````,`0`4`8`<`D`L````0```H`4`8`<`@`D`H`L`P`T``````````````````````` ````` `$`(`,`0`4`l`p`t`x`|`````0`4`8````@ `x ` ` `,!`!`!`!`"`#`#`<$`$`$`$`t'`x'`|'`'`'`'`'`'`'`'`'`'`'`'`'`'`'`'`'`'`'`'`(`(`(`(`)`)`)` )`)`)`)`)` )`)`)`,`,`,`,`,`,``.`d.`h.`l.`p.`.`4/`0`0`0`0`1`1`1`1`1`1`1`1`1`,3`03`43`83`<3`@3`D3`H3`L3`P3`X3`|3`3`3`3`4`P4` 6`6`6`6` 6`$6`(6`,6`06`46`6`6`6`6`h7`l7``8`,9`09`49`l9`9`9`,:`;`;`;`;`<`<`<`<`<`=`=`p?`t?`tA`xA`B`C`C`C`C`C`C`bAb EbIbIbIb8Kbd>d?d?d@d@d@dAdAdAdAdAdXBd\BdBdBdBdBdCdCd(CdCdCdCdCdCdCdCdPDdTDdXDd\DdtDdxDd|DdDdDdDdDdDdEd@EdEdEdEdEd`FddFdhFdlFdpFdtFdxFd|FdFdFdFdFdFdFdFdFdFdFdFdFdGd GdGd,Gd0GdtIdxId|IdIdIdIdIdIdHJdTJdJdDKdKd`LddLdhLdlLdpLdtLdxLd|LdLdMdMdMdMdMdMdMdMdMdMdMd$Nd(Nd,Nd0Nd4NdOdOdOdOdOdOdOdPdPdPd PdPdPdPdPd Pd$PdPdPd0QdPQdQdQdQd\Rd`RddRdRdRdRdSdSdSdSdSdSdTdTdTdTd0Vd8Vdfl>f>f>f?fD?fT?fX?f?f?f?f?f?f@f$@f0@f<@fd@f@f@f@f@f '`8#(#x;seagate,dockstarmarvell,kirkwood-88f6281marvell,kirkwood&7Seagate FreeAgent Dockstarchosen?=console=ttyS0,115200n8 earlyprintk root=/dev/sda1 rootdelay=10F/ocp@f1000000/serial@12000aliasesR/ocp@f1000000/gpio@10100X/ocp@f1000000/gpio@10140^/ocp@f1000000/i2c@11000memorycmemoryocpuscpu@0ccpumarvell,feroceonos zcpu_clkddrclkpowersavembus@f1000000!marvell,kirkwood-mbussimple-bus0/nand@12fmarvell,orion-nand o/sdefaultokaypartition@0u-bootopartition@100000uImageo@partition@500000dataoPsa-sram@301 mmio-sram os pcie@82000000marvell,kirkwood-pcie disabledcpciT pcie@1,0cpci o-@>Q _qs disabledocp@f1000000 simple-bus pin-controller@10000o marvell,88f6281-pinctrlpmx-ge1Hmpp20mpp21mpp22mpp23mpp24mpp25mpp26mpp27mpp30mpp31mpp32mpp33ge1 pmx-nand*mpp0mpp1mpp2mpp3mpp4mpp5mpp18mpp19nandpmx-spimpp0mpp1mpp2mpp3spipmx-twsi0 mpp8mpp9twsi0pmx-uart0 mpp10mpp11uart0pmx-uart1 mpp13mpp14uart1 pmx-sata0mpp5mpp21mpp23sata0pmx-sata1mpp4mpp20mpp22sata1pmx-sdio$mpp12mpp13mpp14mpp15mpp16mpp17sdiopmx-usb-power-enablempp29gpiopmx-led-greenmpp46gpiopmx-led-orangempp47gpiocore-clocks@10030marvell,kirkwood-core-clocko0spi@10600marvell,orion-spio(sdefault disabledgpio@10100marvell,orion-gpioo@ -#$%&sgpio@10140marvell,orion-gpioo@@- '()si2c@11000marvell,mv64xxx-i2co sdefault disabledserial@12000 ns16550ao  !sdefaultokserial@12100 ns16550ao! "s default disabledmbus-controller@20000marvell,mbus-controllero system-controller@20000 marvell,orion-system-controllero bridge-interrupt-ctrl@20110marvell,orion-bridge-intc-o clock-gating-control@2011cmarvell,kirkwood-gating-clockosl2-cache@20128marvell,kirkwood-cacheo(main-interrupt-ctrl@20200marvell,orion-intc-otimer@20300marvell,orion-timero & swatchdog-timer@20300marvell,orion-wdto(& sokaycrypto@30000marvell,kirkwood-cryptoo*regss4 Iokayehci@50000marvell,orion-ehciosokayxor@60800marvell,orion-xoro okaysxor00bpxor01bp{xor@60900marvell,orion-xoro  okaysxor00bpxor01bp{ethernet-controller@72000marvell,kirkwood-etho @s@okayethernet0-port@0marvell,kirkwood-eth-porto  mdio-bus@72004marvell,orion-mdioo .sokayethernet-phy@0marvell,88e1116o ethernet-controller@76000marvell,kirkwood-etho`@s@ default disabledethernet1-port@0marvell,kirkwood-eth-portosata-phy@82000marvell,mvebu-sata-phyo 4szsataoksata-phy@84000marvell,mvebu-sata-phyo@4szsataokaudio-controller@a0000marvell,kirkwood-audioo "s  zinternal disabledrtc@10300'marvell,kirkwood-rtcmarvell,orion-rtco 5ssata@80000marvell,orion-sataoPsz01 port0port1 disabledmvsdio@90000marvell,orion-sdioo sdefault disabledgpio-leds gpio-ledsdefaulthealthstatus:green:health %keepfaultstatus:orange:fault regulators simple-busdefaultregulator@1regulator-fixedo 3USB PowerBLK@ZLK@r  #address-cells#size-cellscompatibleinterrupt-parentmodelbootargsstdout-pathgpio0gpio1i2c0device_typeregclocksclock-namesrangescontrollerpcie-mem-aperturepcie-io-apertureclealebank-widthchip-delaypinctrl-0pinctrl-namesstatuslabelread-onlyphandlebus-rangeassigned-addresses#interrupt-cellsinterrupt-map-maskinterrupt-mapmarvell,pcie-portmarvell,pcie-lanemarvell,pinsmarvell,function#clock-cellscell-indexinterrupts#gpio-cellsgpio-controllerngpiosinterrupt-controllerclock-frequencyreg-shiftmarvell,#interruptsreg-namesmarvell,crypto-sramsmarvell,crypto-sram-sizedmacap,memcpydmacap,xordmacap,memsetmarvell,tx-checksum-limitlocal-mac-addressphy-handle#phy-cells#sound-dai-cellsphysphy-namesbus-widthcap-sdio-irqcap-sd-highspeedcap-mmc-highspeeddefault-stateregulator-nameregulator-min-microvoltregulator-max-microvoltenable-active-highregulator-always-onregulator-boot-ongpio