N ``@0 C0T7QT" 3 R @$( U|R I``` ```@``ᆳ (OР iHMP  H4P qOР iHM  H4P dOР iHM! H4P WHOР iHMp! H4P JOР iHM! H4P =OР iHM0" H4P ;hOР iHM" H4P )/@-XAF7tРCJРCJ+THРP L8((0 SSS 8 Ȑghd+ipVa8/*/0Od@P TP  Q:< 80QR:/ccH# - $M<0 @DH 0! 0 0 2W$Ѝ/s@-0`40P@0KP  nPlL`0T\\F D Bs0S  008 T6/ЍpEfLf.f-gqf/@-@40S P@Mlfffp@-`` @P p  @-@P (oPڠP Yi@&ff0/@-%$0 4& 8' <|S S@@ hAi)(0 4* 8+ <0-,0 4. 8/ <0 f(oboxff0+0RA-@P`p`R h B(0H@ RAA AA / RS̴ P/@- R39C R- 0l@*H@ R ` R<\|Q RQ`r l 0@P`p 0@P`p*/0@$$0@$$@/l\0@Ѥ0@ R \3 e R$ l@ B0!:-` R<\|.4 RS<$DL%T\&dl't|( ) ,Ġ̌`r .4\<0RA R$ l@ B0!:-` R<\|.8 RS8$HH%XX&hh'xx( ) ,ȠȌ`r .8\80RA R$ l@ B0!:-` R<\|.< RS4$LD%\T&ld'|t( ) ,̠Č`r .<\40RAL/@-0,4$D@Hfff"fH D H  BH /4 9  |D0 00/@`//@-靁˼fp@-M@x 8 <d@Pb  L8L <0 @C4,00 4$ 0$ (000 00 0 ڄVNnZ z C0c0vV`ʄ@0 @01 0庄xw e#ݍЍ 0Sd$ 00S =H%0P4(40 %0HW|P$ 0Pr|(0 P`p0 pA|(0 dKwlXP0d0͵(P(UG /w0 0Pwd0$0PwPP UQw@ |wP$yw+  0$|/3UPQ +w w$w+5^L>H|U0 0S$ HwPEwPP%a0P 0{n00"$0{ 0$08P@k [PT 0S@0c +PP>'딢P#U`PPpLr wPd2(0 QP/\( w`(w,v`v,,v,` v ```P{ :`ꀡ p (0  p0! 0_{ P\!0 `#`V0@00S Du{$0800SH0<0@0@@S@$q@0SP <0@S0<0k40 P  aP @@0S Wg]glffgggggggggg g0g-g9g_gkgggggOgggTgfggggg@-0@P0  çЍM-P`(p@P` A{ЍP @P(z0 (ЍM g gM-8MPX0S ڔzp8Ѝ &v 0`@[40S S S 0 Az X0 0 00 Pp pD`_@PH D GsP A|zp <00<@ 0 (`,0S񟗈6`8`8`7`8`8`8`7`7`7`T8`8`8`8`8`t8`8`8`8`8`8`8` 0`40S S0S uP p{+; ATPz pPj< 4v`P ut_P 2u00 [pvP ` mu@Y_ uW>0Sp0S 0S ~$0Sz$0400(080m` @$0S.8`9`9`\5`9` 6` 6`9`9`9`9`9`P9`5`9`9`9`9`P9`@Tp P x^@W uX0000   $ Ap 0g(0gO0gfj0gr0gp@-@V^PS^`Pp@L^<@`s@-P`^@P  =00000 0P@ЍpM- 0!(M 0P@10@@@a 0^X`P\ |p  W"0S T@D`yZ;$W@hXT>$|P; @[8 0S<Dq@P}t`P0@  t`w H0W ,@0,@D, 0R qP  kP &r 'rPH000@ 2$Wt $ rP 0000SfqffMfA-0PP0 R0-P 0 00 P00 Ѝ@-^n@-Zn000p@-Sn@VVPPp@@-Cn 0P蜏f7@-Pr@P4n Ѝ07@-P@P Ѝ0@P0/E-M q 0S Pq`V  0p0CC1"c$(ࠀBT ЍT  0 pP 0S `Dp l000PP  mP ]hPbh]hnfZfbf/p@-HM@P , ,04`00D 0,0P @L P HЍptP [`s@-P @`q! @ 0Ѝp@-l00Kg@-@HrP0S 0S G`VP ql`U p p D0PU 0S ЍP f@-@SS@S9gAgM-p0M@UPP8X U l!XPVPP!0Ѝ 0 W`P0 0$00 0gP S000 `pP(00 0_`P#^P _, ( B ` $`P0gP0\S, 0`pVf\ffffM-0S{ `UpP vЍ0J0P+ pp0 UgVH'SS* gPP\gPP 0-?  8Mp s]P  S88P0 1010  Q :S0! 00*gP Z 0!010RPU WpP$<$(<0$$,000L-?   pP0P@DfWf`ffffqffA-$p(`X @,P<D0SS "0SPLo0 S0SE @$olTP 0#,,#4 <0 Ri P:pXP 3p@P PP wR|oplRP` PP L`R0S <Ѝ0S$@"TPT  0"\\"$P,PUT #,,#4 < 0S00T0#S3k@x`op]o@0#,,#4 <00f>fDf`fffVfffqf(fPT?P@0oP8-oEP$HPU pj00!0>?W !,4,8!  e@PP0S 0S "<<0"00W e A>PP  Ѝ ggUggEgf0/Rp@-@@`GoP0nQ F@P@nprffE-BXMP`0@p(o00S:S#SQ  WP 0 S SlnЍ\0 0 G0,P000000 0ggh,f@-@@TWf@-@hnxP&Q0#,,#4 <0h SdPPQq< QP, (QngggV'ggVfgqfRD0A-Pp`@n@P`U\gs@-@PP ,0`$`n 0 RЍp\g&f@-,, L0 L W Ѝ]hThm۶ThR@-j-g-M amPPЍffM-@P`cXp> )X\thPt Gn  Cn ?n0@( m0 d2"TP mTX hP6n@cP@m hPcЍl hP cP Lm< hP ccP  pm hPm@ncP  ]m}hP m  m m0@p Em0 7d 0 TP 8ffcgfĽff\ff ff:fwfٽf߽ff@- 0 @AWЍgp@-M`@APP V0  -R mPЍp@ @<@ pTB|@BP 8lP|0S@@@5ffA-`0BSpP@T +VP 0 DRU(0^0pA/g\ap@-@~PP10#,,#4 <0 SP U P| 0Sp @0@#$(#4<@SOp Rp@pUfV'{ggggggR@-El@ql@Mf0 gl޼f@-  `l Ѝf@-@|8M@P`U pPX< L0@ @0U` @0pSP 2l8L (lu$l g t P llllptl R  l c b ZdkЍfffffffffff"f1fCffKfgVfhfqfyffRA-@PD`B p-UP 0 A//gR p@-@&l P!l@f kp/᯿f-$M f00 00k$Ѝ߿fE-PM@B00( 0p`8T0 l P Ѝ0  Bhkb!0C0 0P0000q>0 0P gh\gThhM-S될P N@TЍH lI0.0O.@DJkH`HpHD  R @kVp N@`ff5fh0h 0 B0 S 000C P 2#0//@-@.PafpifW` 0@0FS`FP00 P Ѝp V5P  P 0d2#0P` V`PV0  S 0P0S0PP0;S0k V 0< ?bcP0d 6#`VQ0@-QN W Q@!   0xg 0?R    ,,   0    BRʌ q    Q [R0T100D[L; ]R  R R@!   D0]Q00 : `SPZP >=g :  W 0b@Pa 0  W  0gS0W0~W0sSx  O @P3n[ Ws[4O p\L0nS@fP0 RS PnR U M( 0W  f`vPPV0#,,#4 < lf [ uaPKPpa@VyP0VS x 0 ePVaS  sSOtl@C@lS W㘧 W @@ OPPT9 0 NPP <ej00U00S eQ (eX 0MX P& 6Q Ae@TڰY@DXP K0@SJꬉ```T`h`h`h`h`@`HPAeT tP! J0P#$(#4<L!<< !0PsXAmeXAfeQ x_eTlAZeX\T `PxNPW Q@P)OMR@P"O~0hSW00gSd@L`P @ T~1 #$(#4<U0d#L$L(#4@<@0#$(#4<e00#,,#4<  d00#$(#4<d0 0#$(#4<d00#$(#4<ddd0\0#$(#4<dT'0(0#$(#4<dT 0 0#$(#4<dT 0$0#$(#4<dKd _P e <$<( 0 00@ _@P :e p 4e 04O _P00pSKqPYdWdX0 dK@P4N0000 0AdaSY d @pd0 'P@PNnIfff~?gfff-ffffff]gf$ihaf@ff|ff-gfgfffg'g f0gffgffffff&f3ffGfbfDf~fffffff f$f;fRfiff>QgfmfffffOf [g$mhdS WdP@PiMHL _P@G@WP?d@ ;dPPE3 3I ^PW (d4;X 0l000S0@ gRp@-P`< ^@P  0p@7 PF7\pf(mhfRaRM-phMP`EcU@ 0 SPP0 @00 0 00_c0 >Z P  UchЍbP)P$ m ,, 48 ,,Ġ ? z0 @ Z P00@E/ffff\g@- @*RcT T T }cTA00*Spc$S/0{S  /S 0}S00:M-Pp`-^lAh ^PK"^XGVP! @]U?ԕ````` `oPPP @UX`h`t````DoTTTTT@ Tb`ffR@-@NP0Pp0 44EP o/f0P@- R 0S\  ST  PSL  0<Gb Ѝ\ P mggg ggA-쀟p@`PPPWP WbP`vP 00@P 0 xb @P TX0 bLAT$0 (a\g!f4fmhmh;fAf_fffR@-D@@?P ,0(0P ofmhmh@-*P 4000j@P  aomhmh;ff0 0 0 /\mhLmhTmh,0 (0 $0 0 0 0 /HmhDmh\mhXmhTmhPmh,0 (0 $0 0 0 0 /DmhHmhXmh\mhPmhTmh@-DP @CDp@-AM` N@PP@ SP`taAލp@PG jO P\P P PP P Qag`gf 00S/ 0/\mhTmh$ 0S<#?/hmh80p@-4P@T(@PpDD@DmhmhhmhM-?Ml XpС`Pzı@[^ C R C PT QP] P[ | p!Q 1DP QPP @0 @W P  ` >@P0SpdxQ.C ~W0U0C0P!V`1@@D7]0 |@`zh P HR0 LP?ލ@ga.g'^gfp@-@P0P1@oU@ !a@l`bd@PCP 7C\@Tu0s`p n`0PpHf@gSfwff\gM-$`@PU `PV `VP`pP pZ D`\Cpi\B P[[`P  t1`pPX6X`'`@Z @!`$\BF\BPЍ5[ @P  `pPe5@_5%P5 5% 5 5# 55 5*4005% BP P@B`b B_ @ 0D 00S0+*BS `@ `F0S@`CzBF vB`B rB? ` @@,"/? 0 S4 K `F `_ k&@t00WB0" DX@`F= R1 $`@Q  0?S@2/00V=B <#O?@ @P3B P) 00#000@ 00N00@(t3@00 -x`30S0 8303/SX<0 8R010 0SX b p00Ÿ02#0 S0C0Ÿ0 0CS@I~S@D !S@? l @S @5 `@\ ?\@,ŸS@@& ŸS@ @- S# @  NS @  1S @ S @  "0 0 00@~00000 00Y00 @0 0q00#00@Y00 @00@ BX1@00@Dd`AP rA,[`VTl0 l ^u ^0@Pq_KgfPff\g*ffOfUfffLmhԙ`dmh`mh`mhmhmhmhHmh,mh0mhhmhDmhCmhTmhfgffRM-,`0尰尠@0Pp 0I@P ^p X P ^p v0 S0PPp@ЍmhmhDgmhR@-$@^ 6^mhfR@-0 B0 0 jF ЍFfR>p@-`IPP9^@^P U0U0U00U0 R  BU0 R  BU0 R  B0S  /pRE-@M4`cI@P<0DS qpC^ܠ0P=^0 8^` HP @ T0S PBP @l0P]@X ]ЍT T00 `@꜆ffmhffM-@Pp `IPP+ ]10@|v]U`Edp]`\?PW @P< -RW `e ^ R@`ЍUW@I]UW@@]`UW@|6]`W \`-]UP(]@0`"]U,$mhmhmhg g%gThgggR }/R v/A-p0BS,HPP(n]0 @ ]X` `]0P:U``r U @` UP`*mhR M-@TH`P9]\P3]Pp .] P,v? /mh5f7@-P@]0 -R] Ѝ0p@-P @Q(\0 Up@\ \jfyfqfRM-XME@`7P 0=0P7`060D7< 0708708007090(703 7p0<0WP0ӅU= 7 6U 9 8U \U8#80700S <eWP t2\ XЍ\8z.<0iS4U6@`,v,`@TZ;00:0@ .P@ :0$ 0;.P /P.ş 0$ ,P  [@@rS6@' wSa6@Xe08PSS*!03>0 1.P0  [PP 90R`S`S* [@@08pS!*|4< =  l46 d4 \48 T49 L4# D4 t` X [H[P .P  [PP9 3R*@@mS16@sc08PS#*04@0 -P4 0# 0 4-P a[^[T[[PP90S*@@( <}VP8 Z90$0 SC[60(00S{:R@` @0-P  ,[0(0`@$0 R(0SD[0Tb0$Z  Q 3Rp X 0C0AS 0 [0 0 0R:Z1`SP 0R"P0! ZW 0%R $3@P!0 | Px! p ZZ 00R 908T301,ZWT2R,0',0S SWR H <UPqU-,mhmhmhmhmhmhmh gffgLfPffSff0g4fMffff)fffdf ff5fKgTfXfHf`f[fwfefxffs@-`@ P [QЍp 0-R  R  Z00 R RM-P0`M`5p0(0 50,0508040<040004040400_,4@`{UP00xSU,P 80(0,00@S ( RwV $0SrV0X<`Ѝ0rVpH0 wV(W {ZHp8#80W= .MUP, J @T`0< 08@ 0KrP4 0kPpGW 0GSWj+@P , (YPlV+0<080+P @80,0(0T, (?P80 0S4p0SZ00 00;/PP 0S0 ( 0 ;/Po 0PU 0S0  Pa 0PUP$ppY$p0SP80gY P0S.pZ,0 ;/0S   ḹP TLY/0 $0 U(?Y ("(:Y 0SP/Tr P3+(0$0,0080 0<00000rV40 0 wV t0$ `L0 H0 @0 80 00 (0 0 8mhmhmhmhmhmhmhmhMfsffffffp@-`@8UV)PdY?.'T0P d 0QR` UP :p0A ^1#!0<PdV0  0`P p(P\^000'nQ 0S S !S0 SK000 nQ 0S@ S8 4!S00 05K T0 [\0S S S0  RQ    pZ\0RQ\RQY p 5gmggg g15gT5gy5g5g5g@ 0@-P@T \mhM-HM@0`Q@0D000:00 PpP` \@PpG UH }U00HЍPW P P0P0U ;P P00 0 0 0  0Q;QppP9 ;QV@ @<@0-S"p@<@<0@S0$0(0<<$(<0(S00!)P# 0 C1S$ C!|C0! S0#!CC/0BO #4 XxC Ѝ >P>P!)hC9gVgcg0gggngE-@MP>`VC, @p, @>P, @ PB,9@tPC , @?CVX0  C`5C W 0|  `00!00CS ! !p(H`!10Cg>P 0 `CC, W@ PЍ@P pT@B I>PE>PD0 n?@ @P @P 00 3@fgghf gg(gg,g@- M@  s k Ѝ@-@ tCPЍD0 C@P D0 /?4/Q/@-M@@< ~P BލgM-PB1@!  10010B1S pB`B@1SDЍMwB4tB !(pB$nB#!"!ZhB$1S cB$^B䰟J`%1 S@*0  MB+10S S SAB0Q?7@-P vAP0@ Ѝ0D0,@0,@D, 0Rb>0S *?P D0)?R>0SHJg@-`P0HgtaR/p@-`MP @<P @30S4AЍp  <P A <PU 2%A 20S|  <PH$ <PUA@ppAp@P`w L <PoUӳAP\`PUA A 9PP0SSESF0C Saaaaaaaaaaaaaaf0C  Rtp*A@U* \$A0h #0TdX%X $ Qp  A A@A@A@@@@0h 0@E <PЍp@t |0Ѝp@fuhofKgfffff,CgffdaffZg$f?fflf=ff|fffff_ffHgM-`2M@5p0yW.+AW@( %AWP# A`P$l @0#,,#4 <0!SP@ЍP`00Sa0[0W0SXZ p@Pp li@U\%*0 W  $哭吭[ [ [ ,E@ <#;@ 0r"P ".@0#̠$̌(#4 000 03 PT @\gfUffV'ggffVfgqfEfffKgvffffA-pQ` -R p @0h0P0`FV fSp 0SA 0 1PPPhGh@-PRA-@PD`B p)P 0 A//h0@-0,MPP 0 0 0 (0P  P0@T \?@,Ѝ0@0 PPP1@PY"6$?@GhffRA-@P0 -R0aS@DP tp`V@ TP @ @j?@P_?p`9ffM- M0 ` 0 P HX= @ -RF S4A? [Z?XpG Y:PB ?X@eUPQ T\ @Dp U40PY ! ЍdR bR cR rR tRSN0 SI0 R@S@0P`U@ 0 R0S @T>@ >X`&0 0 0 P@y1Px0x>U`&0PC0 0U`&000(fgxffffPfGhLhff@- L\@-T ^  ᦬@T aT fT @( \^ g#fR-,M00@ 00 0 0 (0 /o,Ѝ/GhE-`,MVP0-S =9@P\(T!V0000Sp0 00,Ѝ`F0S fS99pV@c#pP,>0   BQ PWCh000000(0Pp ."0S(0 >꿸fhGhfLhfR-0@-@0AMMAލЍ0@P0P0 t =h ~P0L Q  i0 P 0/fHfOfR V/0/h@-P000 00 Q, 0S  ;ЍOfM-@M@ p P` BR'-Q. >U  +W`F@A P |0@`/ P0`1`v=@ЍsQ bQ cQ tQZA pZ= pQ @Z4 V@ЍM& =@ P += pX00@x@ 0`X 0P @6/`PX U E b2 c GhLhVffff@/ 㸶@-e&HeP %!+&P 5&EP&9gg?q9/ /@- @$"p!p||0h | | X| P | H| @| 8|0! | |$|(|,|0|4|8|<|@|D|H|L|P|T |X |\ |` |d |h |l | p| |t| tx| l||0d ,aaaaXaa0a f,a`aff f`$c)a`"f"f<#f` f`#fD$f f,a`` 0R000/0 P/0/ @0S/th`<갇g@-!PY<wg@-    @-2#PG<gRM-020P@T 9<qP @Ѝ@0PU zx#<@pW?70P80<0KPP `@pthf-f9f0P D /   _P R=@o//ῷfp@-P0`S@ d00e"P 0S  P0 00ppM-0@S R<q圁+000QS`p0l!0070 `9P@1`9`41V# Q R R`600P 6P 000S, P x6`0 S P6`p6` V*6 0P0@c6 RD0  (0 000kgrgThththphp@-0PS@ R0Sp000`a! 0    0 pp@-@P0 P0  000p@A-0PS`@0S 0S 0SU0R lr L.6PG  ;  PU UPP  0 0y @oPP PPP0 000 P 0 n 0S 0S2^ pX0SP Pp0pq0!P J\R00 R!P 0G  0pG0 00S00 0SYD\R0  RhM-@TP `R  X PUP000@ P Rp@-@Pp@J {5P \CP pƼf0/p@-@Pp0$S`0P 0T@ ?S D0D 9pPU 35Ppththuh g|!M-00 n5=p?5PP 0S@,0@0T `P? U5P 75P' @X!0S@tX0S00j35.5@ @ 0Z`@4P 0S 9@꿷fthP?gM-@P` 4pPX 4B@4 ` 4PTЍU G , @p4`p4 : 4P+ ḦPP82PP40S 4 4P X 0 19 A  PX:  U!P00000-S =S0 +S00t4P [X:   0pS g4``@4X4T4PQ4`@3`lGgA-PPM@" @T p /4뤀@P 0S 14`3t30@0 0`@sЍ0@0 0P@/a.a0gM-08MPS `p0,0 0(00$0 00: R Q R Q 0R RS6<7 p8Ѝ00CS 0P 00 S000000@X``V `@`V` 0SPPU0D0D $0ST TR0S 0S"000 0SM 000(03, 00C0 00P= 0 00 0,00( 0 0`0V0k,0 `0( 0 @`00 DS/o" RM?o2TQIT00S|0$0 T T[0SH @<a`0S0 0S  S` 530PC;30 00,0H  ~ 0(2 0@2 0 2 0,0 0000`j 0  00S #S 0  `V p T0 S000 00 00Sp*0 0pPXZXD `2=2P)0v00S `0P0W"00 Rp T?o20 T   W 0`S @M01S 00C0p0140>0P040 RV p P0 0S0S00H p00Zw20  *d1pw0P!pCpp0 o_204p 0S0`0 20S 2 140p0S 1>20Z 000;&2 P p6;0<0P A"Sr0$0 @ $ `Qthgthuh;g,gMg;gM-8Mp@ \ `P4p$PPW(P0P,P< $N,,$6P00A00-+(%0S 00 03/pP? 50So U 03/[ ! KQ\R[XDPZ U+ X0S(0S[  0KS R  [ X X9R7(0S4P,0S  w` v  X4`R`` D$6u  ,4Rg00ScV8Ѝ'U#!UU 3 ,0PS0S6000 000"PEU\KaHIaIaHatKaKa\U |U ;UX 00#03/ PpN 03/z   03/ u03/R00  00003/0000_P0S 03/ ?P {P  $G 000$  03/ 000 03/ 03/}Pp}Pc00 03/'PpqS0SQ m0/o"0 -&ZB 03/g#|Z8 03/]00 03/Pp 0S( D|0 ,0S 0 vL0  000uh0g0gth0g0g0g8a0g/ath0gf@-000,0000 000@Ѝ8a1ap@-080/ 0 @8  B8 8 . 8 8 H /H0B8C0H0//@-0  80 6CL0P 00  p R @-pll00#,Ġ ,#4 < p l / @-f@-  @ϡg////////////////Q @-H L B H H L 匭/l0S l0!<<!0000t0tH00C0H0H0tp0/H00C0H0H0P0////M- @ HP<P!@'<0\ \ 81 3 #S41 B2s2 Bs0B0Q0CL0C?B!c 0 B~ `b0vp07 P T!00U U813 #S41L2s2Ls᠑ࠁ0L 0^0C0C?L1c  C `c╬1t' 1p7 Q 0 RP 0V3, O' 0-ggfff?gqg4// p@-0 0PP4P@ @44 8 p@H00C0H0 00p@-HP  `0Sp@@L@3/0P  B3(f+f///0<00/$$0$ 0C0L  /`@'iuh@-@-<4gD@-6P b0@l,$  嗠g\gg_Kg@- @@  2gg@- u2$2 22 Ѝff0gT X ThJ2@-8BB@@-G/////////@-0DP80`0S @@L@3/0P   B2'h+f@-@P` PU*P0S*0P * S@(: PSP#* S t.̠̌x.`Pt&x&dl`t&<gM-HMPp`0@P(0$ $ 0BS(0S  1HЍ!8S0P0$ 8 R:0Ġ#  #4 <00, ,0HS00 0S (00 40$`P" 4@T!08  0"LL"$@,@Z*!80Ԫ0 89P 0@$(0@0 pp 1Gq0 W4p0 8Qp@0 pG`! 8ߪbfufM- $P`p%@PZ 0  M 0 (P@A-`pPp P@ 0 0zffg7@-P`@P\0T@P@ Ѝ0,00 G@P ggggQM- MP Ѝ`@!pPP X 0  SR0D 0xPc P@x0G&<$<(&d0l0P"0 0`P,*$<<4J(0L00 0PP0F00h 0`P $<$<($D0L00P*0f/g?gRggcgvlfs@-P@P0 ,@P`P Z+0 `P@X/ЍpHG+<0< @P@gflfgggg7@-@PP  0 Ѝ0@/ Ѝ0IfSE-pLM880 /@LЍP`S@P / @P00 0<P0H @ /\  ! \ 0 JH 0@Pg( @yfgjg(Pgggf@- 0 ЍM-(M@P\xq`lP=U<QN0  P |*P- l*P/8*▜P!  P- / R& [0 0 0@00 08`P :0p P 4. X(Ѝrg{gCfggg@-PPM; `C@pT 0  SU-$ 0 LĠL  @ @Ġ#  Am #4` <0@!@@N@@D$<<0$0R0Ѝ@0 @0P0Jgp@-PU.p@9`P/. v$0#$(#4<Q .0#,,#4 <0S 0L#$(#4< v.$t.00pQg|ggg0gp@-PP<`@ 4c.@p)P @Tuhhg0 000 /uhuh@-{@P @@p@-@P ,0S 00S PP </.p,0 @00 @ R@pguhuhM-|`|@Tp.h4pPX   . 0S 0.P U@ -uhgg0gg@-@P 0 -uhgp@-@P@P )PpP puh0/uhA-tp`PU`-4@0S 0S (P@@ TPuhg 0P/uhA-P`@P,p0 7/Ps@-@P`P `00` 6/Ѝpp@-PPPEL`@T @?<0Qpp@,r-o-@uh{gg0guhgA-`P 0pP Ѝ@L0T 0 P0!50!2?00 07@- 0@PP 0  0 P d.-`,-0 ~P <0 0 d Ѝ0 gggg7@- 0@PdP0  0 YP`0 QP @<,0 0 , Ѝ0 g$g2gDg/0!!"- *,-+!0 8#7|#7 R#|0S|ǐ0@-LMhPU6 ' % % !0)` @ÐP 9S)PU9S LЍ0@-h$Č0d0(00"(  Ѝ@-M'PP`0 pPP@<q,ߍ $j,@  ?@9 ge g@- @R010h01|0 S0# S" S0 I,0R00@Sh|  P(@S0h000긮fgM-M8d@`pP0h d00 8#8 0 0OPPUЍ@-X`%X  p@P00 0P00 0P0S0Sh0 R0 R  S00SP Ѝ迷fSp@-ɀ@PPp9PES-(U0)  Pp/70|/@-g0@hM`K?p000 0 pppPP ot0 6t0l06l0Ѝp@-HM'@@ ` 0`PPP k+HЍpe+gg@-@00  40Ѝp@-GAM0PTʌK+ `V &1S00hČ(}?!"(00 00 0 jЍphgQRA-P  pS00S"M0(@R`@ 0P"0S08090 PpG@0"ލ0@S0T?000 QS1:   M- M@\`PU'ZpP PP 0 jpPBO *h` ЍP p`Qf Rta≤ap `E?0 SQ  R7 0Rc R' Q4 Rd0 S! aV O ,P1Ui`aF 0K+ 1GQ0%10&10pv 0C#&! &! A 8`*S(-v * 0 %ZO*J%!  00 K?0 $ "$ Q S 0Z  n <`0VP0hd000 000!  H`P )*`=l`p`t&(p ᛣHP ᖣ ᒣQ 0 Q 0 Q 0 Hgggggg5gXg~ggggg0g'0A-pM0P`@P )ЍU@PX d0(p"(00   000@P@)8&V ЍA.@P gg'/A-,Y@p`%0S00$9'vP $s)000%P@g@-d0h00 00(8Č#8"(0 #0 Ѝ@-@\hM*)Čd0(0"(0 0 0{Ѝ@-d0h00 00(8Č#8"(0 #0 fЍ/@-&vPp@-0hMČd000 08#8 @ 00 PH`P, P 1S 0 $ 0< <0#40ЍpM-M`p P@PI@ j@>NP_p c@P, A% P@pWȰ@|( x< S   S   S  , @0_@P dtЍCgM-P M, %@P `` P5Pp W p ,P V 040#40   0 01S 0 0  S 000 90 t1S P0<0`0@S{ pSs SP4n 0h d000 00` tPᗌ&00?, `P,90p80Y pp` 9VrqP (Wp1\$`dWd 9Vc`s` 9VcP0S0043@T 0 0C#0 0S 9$0Pt:?0` PV+$0Pf:0 0 0\`S2@01S22p`P 8`1SV0hhd00&h0 000 0`P ݍ` <`{QP' PP0  p0` 0Რ0 000# 0P:   00 0@ 0z  3  1S *o  !00SP ]0  g  q   R 46'U004ghuhh gg@-#@9 R  /@-@M0h}?00 00  0 !0HP09hx# 0h0R8l# 0h0G a#ЍIp@-(MP@ ၠ0h10P}?0 0P 00 0P!0 \@# 0h0@` 0h0(Ѝp`M- 0@Ph!0M!0R3D 0G@A@0`04 0G@AdpWM h   2 0 0 W00}?0,00 0$ $ `9S< 1 0 09,0Z`09 00S0 0h}?0c0 000!0 `PI 0h0I0Ѝ,0Z [0K ,0Z 0pW9g0@-000@%00 $0` Zp_0S "PU0S h&P 0S 0SS P` Ѝ1S S '7gM-M'`@P`p 9 0Sip 1#4,01-01SPB [ 09,03/Ѝ 0S/ h00b02000d0 0h0c 0S[09 "0S"R W "-  , 0SSS S X -  , 8 %$!  pPgVgp@-\@P h`00b0200d00 0h0 0c0003/h`p vhM-R MS `p@ "!HAG;0 b h`S'< U X!'(%X!000(%4",00 0400 h`d ˞000* 00 0b 00 0"c0 t0 P2/P    00S 0 H Ѝd Zp` vhM-R MS `p@B "i!HAو0 b h`S'< U X!'(%X!000(%4",00 0400 h`d i000( 00 0b 00 0"c0 t0 P2/P    4 00S 0 H㘈㟈 Ѝd Zp` vh@- h}?Č00 00 0ЍM-<"0M⣁c 0RX@'0 pwh0to``p1000d003 0b0 0 P:}?0q 00 0P4X0/\  `0gh d0P0d0`aS ` X}/ P  h eP 9 X  Pp} 00 0 Op' 9 wpPP T0R0 0CS 0SdP Q03Ѝ9gvhUSBCUSBSs@-tYT`PPU<#Ѝp0P@#L!g/g0 /vhP@-(#$@$#P`agvhgA-XD`&P!1pS="10CS9@8 KpP"1 0#1 0S%PS&!1Q!,000 !R  5P 0S 0S 0S 0S 0ASx# ! 1r#Ѝ+! R*   +! R*!  .!% 0  Q %0S0%00 h0 \0$9ᲇP0 S4181#81:03I괎a\aga8ag@aM-MCgh0 0` 0P b0 00b0c20$00d0003/pP X #p"0S,0:S TuZ&-0, "<" 0S Ѝ2 320  0⽜ E⹜ȱ  Zⴜ 0$0U0^0  tb0 20 0d c0 00 3/P0'p0p0 ?P 0W00 S [8 1! QP5  P P4 P000hS!S 80|(0S0S0l(0000T8  (Ѝ;0@0 0X P :U\Тadaxaa`aaOP[P !=10@SKaaaaaaaaaaaaaaaa|aХaa,aaaaa!0[S0(00PC0P ~P"010CS aXaHaaXaXaaa"02S #00@S$ͅ ;0@0 PU*PY~P %"(00CP0@S a,adaHaaaa`aaaaaataataaaaa0aaa0aaaأa0SQ 0APK00  0. 0 G '%UPEK0P 0PEPPUP0U* PPPU PEPQ*PEU 0  0 0  [*PyPUu*$A00CU0:iPQ 0E0c*4(PEPPUQT #00CS0IP3 R BqQ3 Q2`#0SLS 800S000Q #QU [QPP  RKt"m00CS0P U:000 P P 000C 00;0 0@P0 "P p W WdaЧaЧadaЧaЧaЧaЧaܨaЧaLaЧaЧaLaW8 WD W- 1 RO WD00d 0 PPP 0@0 000 0p0000 0E!00 00C 0 0S0P00 k0SP0 S0 ]P 00 00p0vhPhLhhHhhvhrf-gfygThg g tThM-M@Pp0$ PUPUiPDh\QS`@'V \KPE`/\V \ [@N `\S S# \Q'V00S0'`$VQPE`( 0 {V(V000 U `@PPE@ p}V)V 0H C Q S0;0C$ P@0ppPE00S U00ۍ040/hp@-$P@<03/P p@@0/hP/0 ~0Y/ R/0 ~080S//h0Y/ R/0/0Y/ R/0 000/~h(0S @-3//p@-PQ P@Pph0TQ Tp| P | H| @|08  p| ,|0$  pphXaa0a faaP0<0//hP/0 9~P00S /0S @-P rP 0\hXhs@-P P`@b0 S `V ~p PЍpNH P 4 P  obfefhfmf 0 /\h0/Xh0 /Xh@-@P0p@-@P0PP p@O0pA-p@P`nP |iP hcP 0 U 0*/g/g/g_f 0  0/@-@QtpQ `\Q @H@0@ hlAgtAgAgAgAgAg gp@-r@P00ST U P`@@T000pHU  R/o"HPC H@CUT 0hhp@-P`P0@0PS <00S:P `GPpphhh 5hhhp@-`0PPN@@DN@JD T00Pdp 0@SH00@8p0$ PEPP00C0p(h h`hP/0@- Ÿ 0@@PUQ 0C   010S010@Q P0C P P PQ DP00  0 Q 0 R*    A 1 00 R"182:Q[ TQ"nUQwxQ"|~^  A@! 0^ Q (h$hh0hT5%0 0/P 0SM-U`~V*  BP1 R00 0 00    8`4?0 S&380S[0 TS&6n0US7w0$S&9|0~0 !BP   B\0C0P3 N\00 0  0\ 0 00\000 ^*!B L  C\ :0.0 Ap Pp000 0BP HR838#@0@sJ@N@@]pp ["Z000q G2p00cp@0CN@N@@=p "@00Zp0z X0  0 H000 0X  iwf ^$.#18 2:R[ TR.&n UR'w AR.)| ~ @AqW B!Œ p@ i@W   R p0  fLX00 0 0 0  0 "X 000 0 0 I0CPK O0  ;0000h0@@@p h00S0\ S00   BR0000hh(hT0hh h`hhh0A-`pPvo@!0 0@R pGorp#W  B$R@R0 R0$R00    辒(hM-@QpTM? 0PS`à VD3 ^pQ+ A 0p0 00 [ 0 0 0 HQ0 00000up vPRPJk ^ 7 Rdp   F$R'R R @  $R   @  @ H  00 00zf1[- 0 0  0 0  F$RR0R00@ 0 0$R0 0000@0 @00000006wU [څpP< 0 G00Sf  F$R!R0 0R000 0 0$R0 0 000 0 0  <000F(hA-pQ%PAAP `!`3Xȃ7PP3@/PQ @F)PP /FT*@/@EQ pF0fpppG0GS0p@G00C 0    00@@q@000CS000000b@/M- $pX"@X@@T%`!8 P   B0,X h g<//xxyxP @P///hA-`P8pH@@T @DHPDPhp@-PP P@P@pP 4@-@P 00H LTL H0H0L h0H H L /h-TMP  ِP'00@000<040808040@0 ,0<0wdtTЍfaaaaa qp@-` P@@PPWp@  ݐ00PpRA-`@pPC@P0PpV/9f@-@ 0P0PffP@-T8 I?0P0 @ 04/ f9ff@-M-pP`@.PPPEP0J*`ZX PU `@` 00C C1Th]hThm۶@-@ 8p0mP -* EOfYfdfM-MPS@S100 M`A 0SS""VpP0 ( $0 cP( $0p 0ZW `PU 00 `K!0`FqYPZ 0 P  eP `0Z ` `;fEf@-  \ P<080 T*T04PTT T$T8T4T+T,P ?(40SCY4S+4 4g ı p`P ^ 0 4W A\J7 AuVpGW0 (4(4SC540404S ,04PB`V p`(PP4S/4 $0S0 Q  Q 0Q  R  ABQ xR00 AAPA ^Ua AR\ 0S Q40*40 404ЍuPhg_ ,gM-Bp`)4S4SVS-+4S 04S ,.04P0004 PPaQ+4S+T$ 4RM0 Q*4 $2 44S 44S9)4STUUP ᒋ4`F0C44p04$4P\PP00SS4S PP Q $4P\PP0C48$ S0C08$450C0RP'\[u uS4S0)4t(4SCI4044PB0)4U+4 0#  Ps(4SC1404h/P@- x@40CS!0)4@4/P@ h0%'5/Hfg| |0p@-0C p@R0`P 03/P00p@T@R @TbhbhbhM- 0S  @7QB Q? qy ЍM&Q9 1QE0Z 0tQ bQ CQ IQ|Q$ QZ00E000 lh 0S X QA8aaaaaaaa E0Z hf`V- 0S* 4 P**5u0u#(0嫁᫶S'Ue 00 0`t{Ѝhd`\qTЍM1;fFf[f+ffffvffff0gffffff%fp@-@ 0@`0<00  Q1!0  0#1Z>0?@h1g2g2g22gGhv2gJ2g2g2g3gIg_3g43g-\M0 \Ѝ@-dM0 @p` dЍT P`P8p0 00Pp 0 pZ4g4g4g00E-p0`g P0@P,PE0, 0RT 0S 0SgP Ѝ@,P,PEp@-`P@PT@p0SN@P  p@-@P0S p, 0\/0 S/fzf@-`Pp@eP0avP Ѝ@ TtV>` P0@0,@D, 0R t0PSPP ,@ff@-@`P cp P p0S U@ PT Ѝ@- K@P 0S@ Ѝ@-XpP@ 8p P` 0S  @ Ѝ蓿f7@- P"@P  Ѝ0聿f7@-@P\  pp< @ Ѝ0P@P 0S@꒿ff0<0S 0S /%//xp@-@P p@ p@-@P p@A-`pA PP0@ Ѝ0S0S@ ,@0,@D, 0RPE-@p`0<0S% 00P0 P0 :/V@00 0 ЍA-@pP`0<0S 0 A/%xs@-@ `PnP0 Ѝp@Ѝpxs@-@ `P[P0 Ѝp@Ѝps@-`@P0@P,PE0, 0RЍp30S0T@,P,PE@-p PM-04P{p @T 0 6`P( @ @P 0@ 00? Ѝ `W  [@P@ @,@ 0,@D, 0R@ 00 S|0 00S00h   R 1( R U1< PP3P#2080p0` 0x0@0̪A-0M @ `0Tp4PP @ P00L00H00 0 p|@P 0ЍMfp@-P#@P  p B -0Q 0C?o20#S A0SRࠃࠓ S0p@-mdP( `@  EED`0 ZZY`b`p@hp@-@(M 0`SP@ 0PS  p!SP  0870 PoPP (Ѝp@hgg01 /th01/th 0p@-`GP d0@T*p801< Br/, A, Ath0@-PM@$"  F70 G0})P4  .ZI) 6E EA0'30 0"448!$#8$80:;0 ,00"44,<"44<00,0 0 0ߍ0!gM-a匁Pp@I@" FrPPGo@ T0ЍMPcTd/Q.. U @ 07 00 0000 S  h00000007 S  XVP7Ѝ@ 000@hgq'gg@hhg(01< Br/QQthM-p 0"FP@ࠈ  0`400U } HЍ0 B&,C  E B C&$ &( E0 F4 G2} R0  Lx"". F0  GPgg(01< Br/AAthM- 0 F@Rࠊ {} BPЍ Gk2}p .`0P0VB[oob0 BM',CI E EA B= C8'$ 3'( E.0 F($ G$2iV}' R0  0"". F  qG P` 0p400U } gggA-`p@\@ PP PQPVPR:PU: W @@\H 000B!d 000h|hM-$q PR,0(0,: R) R @   AQ*   RP ЍM ~@PЍ0  0P @@   |hhM-p吰@`PTv 0 00C0@PP0S 0S U0@h|hp@-@@` 0PS0S 0 `P00p|h@-@ ~000|hL0S/p@-`4@P<@D<0SpPp<@  p@-@ PP  o~ዀpw@-@P@  蒵ff@-@P @  蔴ff@-@P@  ffM-0X00R`pP ^PP{PB@P Pu 404080,0,000(00p,0L00 gU gM-`@P& =-PP! ,(pEPP K,  B RW 0 S PP P@[PM-00MQ fpPW @cS0嘃STUTRt``/PUXV0T% 0 p cP0 000S ;PPPP:?o2PppWK vtP@#d,ep epr@h<妺^Xr@0S P0StPoP0Ѝ 0R P 8 ; `<Pr`P\ ڈ`@@X 00@00(pD0@P  t P@P  t Pv 0R 0 P 83P0P R T 0RiP8H<_`+0fPhLhThdg!ggg gLhf ggg/ g-\ //-|/x/-t/- 0d/- 0h/0@-@ R *P PT:@ 0p0@/0//p@-P0 0 0 @X03/P 0 rs 0S 0 0 0S 0 p- 0/- 0/- 0/0/ 0/ 0/@-@ 01/P000@-@ (P`$ 0`1/0Jp0 00C0Ѝp0 00C0E-@ 0RM` 0:Ѝ R   P: R. 0l1/P up000 Jp000 (PQppU 0 e E0UQ3R(`Q  a 0A68PE0 0S0CP08A-@0Mp 0'p0-S" 0 0 !0@S KP0(S`PP)PP4] 60 P *QЍ0@S`00  rP0;00000,Q rq00 _P  U  F `F00Q;Q 8!  gRggazgggfp@-PP@p@O`x@P  oM-`MPpi@TP 8  @Ѝ00 000 000000 0 000800`0SL5`0d0S@5d0h0S45h0\0S(5\0l0S5l0p0S5p00S50x0S4x00S400S40|0S4|0t0S4t00S400S400S400S400S400S400PSp40l4X0!sr 0sr.Gp$0S,p0,Y Q7 $0Sp' c C83172 !00 0   R  S*: 0. \0Plp 0`.sr p0 0S S2:0S 0   R * R  8 P\00% p 0T 00Qf*Sg\ښpW p\:^1!0 . 00$ R,0K P 0;00   00$ R,05 P 08;0D0D0H0H0L0L040400S`p V0*. 0[P00000`p0\0C0Q`fDb,BbTBbAb Eb|BbAbBbBbBbAbBb DbCbCbCbDb4DbPDbCbfͺff#f9fQff00C R/0S0A /M-HM` @ (0pm000 R;R`0P 0 PW0 ;R000 0p (P(p HЍ yPqp Q   P P $*  Qqp00000 00D0  g;gp@-@`PUp@gePM-`@圠ppG0S 0R FPP8 0@pC0 P0 0800:8yfM-Pp` 0U p@0 0蠀  0  0PA-0PS|L(MPd(ЍP@P 8"P  q @T lP6  p`/ 0S, ]PWP; 0 `P 0: 00!0D0$0 0" p  lb@ig,fCg=f]f2yg0S //P 0P/80S//hp@-@Ph`h0aP X8`?0@ #5; 00$0 r@pp`hh(g\hh0/\hT0 R/p@-D@PP6311FPpPppXhhhQ/p@-dQ0HT  p1p!ppl1RL1\!LLH(lG0 1,!0 !PU 0 xV \ 0 l  x0 xxctpQ P< `a 0A531T0 Sp0< Jf gff%M- 8M   s@ p!0 32 b< B`10pP0d1  0 00C0`p0U8Ѝx!RJpa!2& f! F< vp05qf0 1{/0$00400,0  0upPJp    0 P 0  0Rp!02`PP< E1 2E1000ꔰfgffM-@Mp`  $7ȁ( 0 0hoa Al a2`Q X @ЍpA DT@!S @D0P`00<00 0@PJp up 0004040 RH@P`0 0,00 ,$ Q#0  $R# d <(@!\  0( \  !@!  0S0 R  ! @!  M-0@P-p `n2.& @N34  o xV p p!032 b< B10`px1S 2! a, A30! OP Ѝp`M-@MP400 T00paQ0 f F\ ` H  1q36>7<p0x10000000   $   "0B,0080 2&.0,  0 0qw"p,0$0 PpЍ<`C`^ hpqpG4w^ `^ 080B00KS|ab^bxbbPabxbbxbbxbbdab0 C h!A0?2 B<@ b7002i(0 p1 c C3`s0(0:`0D00 0<(`<PD0 Sh1 23 < T00 0d0H000PX T0Rh<6` `b 0PQcQ`G0<00S+i 06#`<0     ` kRp@ i(0000p1 3@0`PV0  00h | 0 h0t 0( 0ကl$0 0$0,00,0P;0q0000 0CS!0 0 U0 O0  I0LS 7l 0 0 0ai i0 :"ᑢ"0Si  `$<@QR `Q  xOgM-<@DuZQ@/ p!02h!PS"0 `P @! @  t! b 0R;"!X#Q0W00J 0 h0W0P0S@ Ѝ 000@J0  0 L@M-0p!@P b `B 1320x1fpZЍ0 3201f08!  R q h!p1<0CQA1  S 2A10 S 0S p!?2 B< b10"op0   B0\Q  R p!0C B b"30<ŔC\Ό<C0[ E-4MPT` 7Pp@ 0 0  0 0P4Ѝ0$000W  0W 1  ,  (PP up Jp 0pG0 P`M-Ph1p!M0B00`@ ` 6b b` B? 3"0084 0 SR I0 0$1/1/1/1/@- 13/ Ѝ@- 13/ Ѝ0R/00R/0 A0R/Ѳ0 A0R/Ѱ0s@-X1S 4@S 1PS o?0 000010La0 6/PX1$Ѝp@/ЍpM-4M 040U080ܴԄp00@`:/Xg>0L PԤ]ZЍ5 3/ 0H    =EŔ 0445S045\\|SS\0 1\\\Q PQ{bbPbbbb |bh|b|blb|b(b|b(|b|b(hbH|b0A-QAQaqQ'A\U U3 ,3 .Œl RI U U3 ,3 .Œl PA , . , .Ȍ l RAUUUU3333A-`d1@P 0 0C0P`h!p 0R b5"!V#Q10`8!& P8/13/1  !RP0h!0P` b 0R5"!V#Q1p'0 d!p P8/13/0U0U03#1300#RA-`P\ `1p@1`1D13/<5S( 0A/ 0pA]@s@-t`P a 0Q6UQ04$1@3/0 00$1P3/Ѝp00A?0@A B_RÅSgA-`pP@ T`0S 0*0 `Pdn0TS Q SA 0CS1!4 e`P@D`S1!0 { 빱fr r&gffA-@0pSP 0*0 @`Pdn0TS \ SL 0CS1!4 %`P@D`S1!0 ;$fr&gff<Q /q Q/$0$$ @-$01 /fr&gffp@-@`P]P*41S 3/P 41p@/A-`VSQpP00\@ 8q07/V 1 3/M-HMh`000S@ 00 P `3:040SQ1 R?V1!0 P0:0tQ 0000 e0 0U4URVSQ $1p3/h14C cA SVBQa`0 S$5(5  3/P`"X0  `1   41S\pW a@`$1 P3/$1 3/ C$1 3/ 0V0C00 R I` HЍ0 R`t`St1P c S431V2Q,0,$1 3/h1p S c431V2Q 0 10$000C000 00W0<00`@000 00040C0 X!1WS4 00R S#00   ^ 0 0 01pR0!000C0`AFS 0(0 4E @DS@ T 05@ <(008040 0S)$00e<0(  6/P`sT01$ 0`P $1 3/ 0W0C0  00C0Vc@0S`_ ]40SK `!?o2"6F $00(00e 0  6/`P>0S01Tp0 `1:0M 0QI D0RE 0010   aY^D0p`1  41S=\00 R< 804Q5T1Sd 83/`P000$00ep0S01T0W 0S0!S  D0 D00B0p0010   ^ 0@0 00 000C080S0Sc 00 0 10$0 ,00 ,0$13/$1, 3/004ST1S  3/`PA`?^`=`A-P0S0R0S0` 0 R@  8q07/U 1 3/A-`P0V0U0S0\@ 08qP7/V 1 3/0@-00 4 ЍA-`P0V0U0S00\@ 08q7/U 1 3/0p@- @8Q5/<13/pM-@M0`1T 8<@D`pP U [  U 0 5/'5S R0 SUP0 0P[UUU [0U 5/P 4ЍMPЍA-`SV P00\@8q07/1 3/0 8Q5/<13/@-004 ЍA-P0S0R0S0` 0 R@  8q07/U 1 3/A-P0S0R0S@8q 0`7/PT13/0p@- P8ap@6/U 13/p@-`1 P ЍM-0MP`p 0 0 00 0R000XPP0 1@0C ? t!0 R b;" W!Q $!02/Ph0;! a, QW Q ! A $ /!. a0, P pPp ೌ!U  R] UPC  P( pWU _`1 450C 001 [05  \0 ZI  0 S 10, u 0, 0C 00 0C?o2 0$00(000H;/PP.X, 000000 10$0000$13/$13/  RP$13/0ЍpGWp [0Z0C0 00PPp@-h!l18Q0C3 `@5/0 8Q5/<13/Pppl!h10BQ0@- 8A4/QRA-@@ SP`p 13/@V 13/s@-@`0PPP*41S 3/P 0 0P Ѝp0 0P0@ 0@0 k0Զfr&g9fM- M4؄ @ 00`t贑중 0KPP" p p000$ RV0   ЍMSV  0  {0 P P Ѝ00 S0 "P   0`F0 00M-ؤܴTԄp@`X $0 E S0* 0MD0 ?0P$ `R 60P4P0 -0P $ PR $0P4PHp@-@P` 0PpVp 0p@ @-@,M`P~41S 3/P" 4p@04 PZ@0 0H0 00 00pD0 ,Ѝ0 P0@pW7@-P@P 0 P0@ Ѝ0QA-`@Pp  0S`FPVlFӃ 013/ 013/v  `1 U 0U1 013/ w01 3/01 G3/`1  01 G3/01 3/U U0`SU41S\A0ES`@0SU41S\01 p3/01 3/Ay}APQA-p0PP``01 @3/0s( v  `1 U /U001 3/ 01F3/ w01 3/01 G3/`1  01 G3/01 3/U< UD 41SL\A10ES` 1PE3U U U U`UUUpUUU41S$\ 01 p3/01 3/A01 3/01 A/01 03/01 3/AN!QRA-@@ SP`p 1@3/V13/M-@4d$(Mt`P0` 0 0P0p0 0 SU8(ЍMP 0 S0$00 0P (ЍX  0$ P HXU0 0 00P 00PE 00 P M-ؤܴTԄp@`X $0 E S0* 0Mj0 e0P$ `R \0P4P0 S0P $ PR J0P4PHM-ؤܴtT@`W 4 0E R02 M.43/0 %0P#$R 0P4P5 3/0 0P $ PR 0P4PpG `M- M0D0t0404P 040@`00@C ` 0V 0Ŕ 0P10 ЍM43/0 P%0 V00V03S  W  W5 3/0S 00`0 Ѝp@-@P` 0PpVp 0p@M-04شT0p4@` 0U 0$R0 ЍMm43/0 dP5 3/0PE ` PЍp@-X1@S`  X1 3/PP pp$13/$1P3/U$13/$1P3/(gM- `p 0Q@   0PSR* 0XM*h1 n PN3Π3 0^8>:W5QQ?W<#Ž0\08:tQ 0U e8URWSQ$13/h!8 b 0RWQP $13/P1S010 0!S 5,5 3/$1P3/U 00PE-4Mp@P `V 0`!,01$000$000000d1 0 0C0P`  0pq0Xd!0P0*`74Ѝ7@-PP @ T@3:P8@PF@ Ѝ0M-p( @P  BPP@ B`P@T  TVU  NVV $ HV@@M- M40404 Դ0$T0`@0[4 0E RV 0 Ѝ43/0 0P$R 0P4P43/0 0P u07/$0RP0p 0P4PJw40000K400000 ElpW0Z010 0s0P M-P(M40`1ش00@` p0 ET p@0⛷' 0 80 8/H0 0FpP0 S  01H P0$S ! 000P0  14 (Ѝ0%$0 5 3/$$0 0$ Q  0 ĔPBb 0圢" 1 00 0 0Ĕ R0PW0%0Ŕ 0L PԤ]Z Ѝ43/0 P5 3/0 H0 0   Ŕ=E 0L PpZ Ѝ   43/ 0P5 3/-Ŕ 0 #! 01311S ?0`10`1Q#f?  !g? 1S_ Q{00 002001rV P !("(R@8 QC4 C2 C1  B11 `l! B3 NRh .^B(`VB$B"Ba`    B6 8#8SA00^A0A0A000Ct1 0CS`1l!9`101 P0p!@108!R081P5S! 0S 0S ЍM/ P!S !QC8^C4C2C0000@ h hf(r&g9f$gNO$gbbĠbE- qMW@`` LpDP`10`1,Pd18d1}PP [ V83ZJPЍhPP cP ^PP XPP RPP xLPP`DPPH?P uTX䄄P P404` 0 XPP $13/X1S+ 1S( 0cP5SkP P UX103 0#UT10C2uR0CuQ0CU0CPC0 P6X1$3/P/QPP~$13/pW$13/0 0 R$1 Q 3/!?xq1#0 0TPU*3/p(g)g)g\)gn)g)gCg$)g))g,)g8)gE)gN)gJ)g)gA-d1 8S5%} 4@ 5S 5S 5S 5S `1  %R   5S 4S 5S DX`1,005P <044$SR% 0@S S S4 4$05S S44H1S4H1R񟗿b(bbHbpbdb|4x4H1S`4H104`$5S 5S 4S44$5S(455S455S455S45 5S3 5(5S3(5,5S3,55S355S4S 5S35%5R %R $R d#SS 5T#SS 3\#JST355SH355S<35 5S03 5(5S$3(5,5S3,54U:4S2"*042525252525252 52(52,54S<40404$5tS(5$5 5S,5 50W 00d"U 18"15 51!,50%(%T4h1!  0Q4!4`1 RP= 9P 5Qh Q:`1 1R0000`14 50#050,1X0(1h0$1l0 1p010000 101010R4PDpL0H` @00#140꟰f2r&gff)gS.h[hb:h4#hlbb bxbbȑbb(b0bLbbb(b8bbybzb}b~bbĝb,bbbbm?< =@;0S(0 S0<0p@/K;g1Sd19d1/p@-@$1Spؘ!Rp0g_0S ?S0240<0fO0 S SfO pfO00p 00p_gR$S"p@-P !@M1S :29"$X0<;"$>="$@"?24/0p/Hf@B/Hfq/0/!/0Q$$@-O p40p4h0 R . 0(    Č Ȍ !," "$,X  - 1=%`t  (48"$<2,S<Z <2Z 0px-  0| `L0 M0PS񟗏b4bg _g޳fwgg"ggRggfffgЕg fgAgpgggfgҖg5ggggٗggMgggPs@-Ѝp`@P 820CS82 Q 0 $0+0P Q; < hg!]`幬 O 嵬 峬; <  Dfghg1gM-X0 SL @Ѝ〽,PD 5!@Pap 厬00@nL`P<p0S 20 CoRP  pP XTPW @0S j@ @hgphth6ggghp@-DP@0S U@ T 060 phphh @-KQ!M-XMp`Pp R Q xXЍ@@P@ lPi [W0@@0T币 S0@0Dp@ @T[pL`lA> Z+   p00Z0S  70D00KS S0 GS (L0C# D MSL0C#PDX H  PX @  zPT000DL0G$0@0hަg g/g=gthdggçg7@-X2 14P\20`2@ P\20 `2 Ѝ0M-pM@ X2 S 0P㬀X20CS>0 0(<"$0,` Pd h 0l T X 0\ 0 0 Č  ,Ġ !  P  0"  ЍX ^P@&$(&d%,l, %T\PzJ P  Q Rt+ B QRp\U0 ! P00!  0I R0 CR]0S\t+R 0p! |7 0+T TX%XUM0SL P 0⬠H0H@ `X"Rᬀ PO !$$( "(!RAoQ  01 0P0| 0`  }zi`@000000 0 0걵fghfBgefgffM-88  < k ;(pS @" 0A⬀2#a0X"\2`P-@0S" \pPP P`R V >`X2V0  `P0 `PY {PU4' 0PЍ0S' 0,0 0塜PP \`50a0 1 EQ \20; JpP0`00 PᒜP Uq PrkX 0 `Pi \"cP# u`Rt;x+`b0C D2X2XiPP` 0<00`@0 0 X``0d<>;D0<0H0L0\+(` B85$0X214P00<`000 @D2`V 0%0 Bx;S $ ;@2X"0@2D20CD280S  $ )X$ "`è DB P0<`P ,ᰨP `0 0,8#4 < ~ rPP 0 0,8#4 <0<00 0,8#4 <0X0 0  0(<"$0,0\0!  !! dR  @  !$$("(` 0AD0=`0 0d $01010 T2s x" ?P`<`0pX2S4`T40Q00000@0<S @ D0HL0PT `=P 0S  S101DH00C,P T0 P T0L0a<0SRx``0P! `OXP P `X2VPk<0SP  3P  S S @ Q S \0R 0  Cx0000 PohV/˴fͨgg5gɩgfשggIgŰffWggggWfg@-@唧@葧M-;@PЍ<0SXQ\[`Zl$ h ꐋ/o"Q R <$ <+ B QR $  0 0[ ? # # 0@  BR# !  R# t+Sh# D0 HX ?0<# XZ$# 0@d `\ P 00" D0@H/^ # " < P " LP l" ~PT0RQ H" |u 0" hoP<PLPPTQQ 0 X `0 $08$(#4< 0 4  (48"$0,0  $$ 0X0X(Q"( ! P(\ 0S110\ S00^0S PPX2U pU`*! 0 !44`8V<#,,#4 < 4 x$ 00`ЍMDfHggC>gg>g>g>g>g>g?ggs@-;Ѝp0`@ 0(<"$,00l PS  `X TߴH 0DڴS P  0ʹ!IBUf= ̌("$, P0 T PD 0@ Pᴘ Ѝ Pꪲf$?0 Ȃ< $(,Ġ0 0P X  TP $  0ჳ@T@#IBU"f}gA-pP; 0E;`PP00J  @0 0,8#4 <0!S Jp@Ѝ@  P T@@X  @< c =0< >$?0 Ȃ< $(,Ġ0 0P X  T/P $  0@T@!IBUf}gE-P;M l{@`ႨP ! pЍ  ? 'P SPupp 0 0`0  ቗  Pp 0P`l ײT  0XҲ 0 HͲ0@ 0PIpe}fgʫgg;gpg-gM-p; MS@P #嬲@ Ѝ`@P0 @P;W ; ] # 0ᐲ@; ;@P;  P ; 0;PP00J  @ J < =0<> ?0(<"$0,0P " 0O|" 0xJ @J ?@ JߖT 0l+ǿ000 0 ɷ@Pf;l ᝧ0P0 ! lK @Tk 0@e0000 0* fPup00 墖 @P0 0R 00@0X咖H[〰0  p  ߱` 0 ٱ0  `V 0 ͱ000 `H0 00( T幱0 p @fgNg3fg;g5fgǥgg$g-gZggU0A-0B00I00#0@0+p"<<0"(0 #(#<0 +`"<<0"(0 #(#<0 <""<<0"(0 #(#< 0<  <$<(0#( <0#<=>  ?04PP  PP;0 0PЍs@-;P`@.U00B00I00!000< 0Y <$<(0#( <0#<=>  ?0"Ph P ;0 ;DXP Ѝp@-{TMWP`  @TЍp@ *l;  0 / 0$ @0(@P W@| 0xD0SWP T0ְ@ l;@P;  0꼵fgkfffE-M@`p PP;S " 屰PЍ+ l+R 00@PS70X 0@PS ; ? )P-Wy  ჰqqPPcl;0 0PPZl+  P! 0h000000 0P L! 0DUl;  Pl+ )l;0 0PP'l+ )l;0 0PPl+ P` 0'Z | PPPPgJuU0 @0U\Pfgg6gNfgfgIgggp@-^@P`8Qp 0  0``3/@;0C@;>p@-80QPp @0  @;0C@;03/PP  0ϯJf6f@-(;1S + p  ^ X R D 0<岯 ЍS   Ff7gp@-P@`} 0@0S Rp2Sp2Sp0?Sp ^  0 0S00" \   \Q/ 0R ^QR 0R-/;/s@-@P`P` 00 0  4Ѝpرf;gp@-n `*@ P:0C:/p 0纓p@-P@Tp@T@T0S@0S000( 7@-^8;PU ;@SH;S ; Ѝ0P -=  08;UyfKgA-@p `PNP T0000 p`P><+0<˄0 @;0@; fc$;S6A-:@SP 0 $;&P$ :S :S ~~* ` 00C S00@00.<; < @;U0@;/$lcM- `(M000 00$00R@0 ( LP00;  T ٣PP8 0 uPPF 0  0  0(0"$<,#|$|(#4<pp?Z W& W0R0!0# * p# p%ǒP`#0PX ᾒ Rs( ;PS0;uᯒ ャpP`  APPK ??Z :0"0 *< $( <0  0#(*#< 0 8PP% h2Zhx~u L:0:;"PV?0`;V/ !P  S00;(ЍMV 0 (PU ` Pt1S20 0 $0P(Ѝ( tuz; 0!凭qH2S D2S |0CD200 tlP 0SD20D2UH2S 0CRD"H2 0D"0p;0p;t;0Ct;0SH"R 0LZf;g}gfgfggRgggA-@p `PᱢP  p`P A M-@M ȑ0S 㙢P! ; :S *:RSJ 0H$;寑SBP`pP 0 0C S v:0: 00,k0{0 hPPP, P P  00x#0 pӬ0 00000D# 0@ƬO+]Pᢄ`pP  oƃ0 0 $ 08$(#4<  0$08$(#4< 0jPP* 0ES$ppcncpcpcpcpc|;+SJ(" ,倬{ 0  0!0u 0H0;,;$;4;( M&U0S 00  0\ H4[Up00;,;$;4; 0 0PP W ( "WPP|;0|; 00;,;$;Hϐ00 0 PP ;S0;UPЍ ;0S 0CV?*01j0 `0S000+y Pʵf!g gagggM-p(;@Q,;S 0;S0`4;H vnP  (00 0`P1 F-[P +m` sNP ` gᾂ|;0C|;0(0`P 0$  坫;S0;ЍfgA- @p 卫(;,aX2 PP-P&0;S P ^P '~+APP 0, ([;S0;PAgfgA-~@P`p80u  Rv 0  @;0C@;03/P  R 0QM-0::::H0h2>0 8;<;@- ` h ጠP P( +}.0 000S0;:Ph  H 0 S% PH PE 0 SGтPP] $ E,˂`PR w F0P$    (10TǂbP 00 (+00  P ( P( SF 0P C9P 000 0 :0:(;  P PEᆂPP E2S0D2S 僪x;S t p|!(0!"Q0CD2@20@2PPЍgphΠg5fgA-@[P`pQp0PU741.( A 0 ( p  p@-@:S@;S @! <*`p9`P:S@;Sn `P 00C SZ*fPU ;0S 0CV?*01Z0 P+l;0C`P` 08 < :0C:fgf֭g0@- R00 R0#01 #0RR@ P0 01U 4## 01 4##  R0  00#01Q #0蜇f BR0S ; 0c/M-4`@0S@pDPP @0CSL0D0  02@P Jt@ ЍPH0S@HL" BR/D2S/S 0CD2@20H@2 UꕬgP2p+0C?L2/0S/\0 /E-plMP@ᴞ`P   ? *`@ 卮Pup0  PT P"čЍ0 P0 0 0@`唥ꞯfʫgg-g@-@0 $08$(#4< 0  Č  0Ȍ$<(0!, ,Ġ !   00ר0 $08$(#4<Ȩ0 $08$(#4<幨0 $08$(#4<媨=0< ?$>08$(#4<P囨L器0@   0@,Ѝ贜gМgggg%g9gMgdg-g@-@倨0 $08$(#4<Hq@n8k0h(e 0 $ 08$(#4<V 0 $08$(#4<G0 $08$(#4<80 $08$(#4<H)0 $08$(#4<)0- (,*Č. +0/Ȍ$<(0!, ,Ġ !   0=0< ?$>08$(#4<d`0@   0@@fЍ軝g۝ggg gg(g7gFgUgdgsggg-g7@-@ͧ$ʧ<ǧXħ\@徧`廧D帧H嵧%岧L寧!⪧⥧⡧`Q dP`0Pl Ѝ0@蒧h00g00Pf0e d剧 Ѝ0踞gҞgggg&g;gPgegzggggПgggs@- 0@4#TTn0 $08$(#4<\_0 $08$(#4<$P 0 $ 08$(#4<AX =%X 960SЍp@/U`።P$0 $08$(#4<TЍp@000080  !gggg&gg;g?ggVgg@-@d\TLD <4,$@gg(g  `@ᮝ  ggP g g gp@- @40S=,0 00` 0  _   1  /  00p x Ps0  d   00|00 S c  ? 0@ W 00 40@0?  d00@-@XP@@-P 0@T 00 84/Ѝ@- @+ P00@< p@-40@S 0<0@00S = dS"<< R<8p@#8 (`,0 `(`Pp> 0@00< ; ;@0 0P- 8#8 PPp Pp  Pp, <0 < <P8#8 PPpU p@P Pp  Ppp@- PPp?M>M @ @ @ @   Pp  @ @ E F,00,0(00(0epp@-L@@ p9 P7P  sD`@  `V0嵂p e@P^6g@-@uq@s@-@P` 0SS  08 ʟ P$`Ѝp;6gA-@Q`pPP   屟6g8p@-#8@` P8#8 98#8p@  QRp@-,PU 0p@/PH@0 ^ p@ p QRA-`0pW A/`PP0@0 0S0 A0 D00/D00/D0$0/D0(0/D00/D0 0/0@-Pț0P/$ gh/ 0 , /h0p@-|P@x`PMTPЍpP   00@000<04080@0 00D@(P,`<0Ç,@hcccccģc<0p@-@PTpP,@0@phh@-@-0<0@0/@-@0/Rp@-3  pPA @P 0 PK P   P  P P Rh寞p P娞L@<] P嗞3.gfPU.g@-O@0/@-J@ 0/@-@D$0@/@-@=(0@/40@-00(0 $$GJ! 00@-00$0$ 4@ C! T @-J  P@-@ <@8 @-@@P/tFhtFh 0 0 00A0 /@-ǵ0@ 0000  q 0/p@-P0000p@0  /0 //@-k0Sp@-Pc@LP pOg0<00S @-@3/%/@-I R  /0@-hPM0U 0T0S $ 3@P 0S qΞP 0S h0 q㕞P ߜ0 P!P 傚P Ѝ0f@-0@0 00Q00;0000/0s/A-@p`ޙP{P V80 40000 ,000 @x}! 0<00S /%/0<00S /%/0<00S /%/p@-|`0#" 04 P2$௙0#" 02#T .p@B"gM-c0}>CcS@p ǀP P B"ǀ$ , 0C28?8 70A20 1PE\TP 0`Bbd!0C2?0ld`7!0A2880P0"g@-@ 0  Ҝ# ,##Ġ ,##Ƞ ,#<00C"  00<#"Ơ 0"4 0<#0":"(0 #" }. M"gp@-Pݗ@ᥚpp@-Pߗ@LPD 㑟< p0 00L刟p0 00pYgjgA-P@,@D,0SD0,@p4<`<`F<0S D0<0<`C00@-  P@TL P@TD P@T< P@T4: @T.  @T(@ @T",^P   \  \   \  0@o0000 0<0(0S /%/ 0?o20/h@-0 <@T% @0 4/ЍM-0y `< 0@ 0[% 00P 0 @;/0S 0#S0 4Sp000Ѝ@-0 <@T% 00 4/Ѝ0 0<00S //0 0<00S /%/0 0<0 0S /%/0 0<0$0S /%/@-tM@P哛0Pp0,PE, 0Rw 000 ЍἝ 0P0T0S``P 0P0V0S@@,Puh@-@T tP@M-MMg@@`P%-00 套,i0p00$YǘvP ᢗ VqP/G? $ 0<0a$P'09LH00P00E0! 01ܱ0C0[M0!"00Кf P   0jP] ލЍ0$D  |P #00@000 幗P  00 0Z0C0 ~U P ᷝP$ R P R  0CP0P 0 P$00ޕ$0 0ghghghg4gf7@-@PL做0 6P0Q Ѝ0@r Ѝ0@ng"ggg1A- t .@P't0P`hAh,`Fp ,0S@ ,@D,0S+0S4v@PU<0@@DЍ3p|P,`,`FP0P0 !D0 ᎖0S,@@0,@D, 0R D0 {0S z,@h[guhgdgygp@-Pv@<`Q,Y0 00p@o%-,Yps@-P@`$_pk P0 Z$Ѝp@-(00! / h000h0/000S/00/)PA-`pP@ t @T PU@- R @00  000@P写꠆f@-@T000@A- `PV0 0F2p@@&0# " ql WP%%l  0`0 0P P諪0@-0000CS @ o0 ;((50 00Ѝp@-@P`*. B0V @ 0 Pp V@F0S`Apf@-00 0 0LPm蠆mf@-00)0(0:Pm[蠆Vfp@-0`0Pp@00 00 P` p@d{0 1 00 V1P0*P}=Pp꠆f@-Z@M-`PP!00C0뀀}0@@ p0W 00`0P0S @͔Z *,倘@!}}}׹f0, M-(M, P plPTT_@(Ѝ U``*?S`V}@P `0   /PV 0 `0C03 0!PF    ! !7l 2 4 < (<0H80<00S-H0000Sr0 0P00`P000|||`@0V ` #  $ 0'l$ $  0 0P@o AQq0#$ 0  0` 0P 00# 0vPѯff@ A-@P0p 0`P@ 㼓$Od0T?@P@T*4cm@W@, P@ЍfM-M0, g0 0S0PS@00 0 0;;S3 0@P -eS 0@ 0`   0 000001l`$00裧 000(000 ppSpp Uk4 ( 8< 0 =1R9,  R B/o "6010 0pSpp706cp`00XR 0?o27<000<40 0*"**b/ 8 R 4<D 2@0@0D P 娖J{w3 pp0pPx`@@@080,8 48 @0J`0@p'Z0S 03 P# "   `00 00` 1`0 ,0,000&00?0 000 7 㡒0cF#?Sdc ,  p00 劒P:(0` 0 00@0 0 1}P*00 } 0  y 0 0)1hPl k00  0  Pb 0 R00S 00S XPK#0@S0 S' S S @"0 0PS S0$ l   $l x90&C0 nz0 PЍ0!fWf9f'ftff!Ϡ\ 0R/M-@M, 08xP001 81jS S> S0`1@  04#$R R RB ` 0T U PUPTU Y ЍB'0`@`0`0Sul"Ah"`0 4 0`@ }000000000000 000 00003/P 0P0000`       0001S8000R*0 88(0000000:00 兔`*00 $R R R R.0R R1 810000 0:0 0 0 8PЍM##Fh#@@,03/PU 80PeP Ѝ0$0 0 000hLhdh`h@-@i<0003/@T0@d@ЍhLh@-@PQ0403/@rhE-PP"0` Ѝ0Sx `@PX  S p `pLh gG g: g* gR7@-@ P@P @ Ѝ0 SPfM-p0BSM@܍R !@P 彋@Z $/$0 R` 0SZ ZPT ZPMp Pe  `PQnPp  ͇1(`:/P3(, W 0!Z U U  R0l 0 0Ղ0P X埇Sp(   P05/匇ZP"<U m,0(4000բ00 ?4` !%XmTmL_(D\Q0Zf_Kg!ffhff+fEfqgqg0gffp@-@0BSRP PU ZPpppf@-@ P@V/hh00_?SP/oh7@-PPP p@0 _P T͊P _ Ѝ00 e_hwg@- o Ѝ@-@!P600S%/h =@-@9o@M-`M00 00$03D0`0 00 0 b0808 0@0PTS(0 0 $ 0 V00 0V 000$0 0S$0000U0S T`Ѝ 0 $ 0 0/0S L ( H032 HH0,00L0(0H;3<000<0H0 HvH?400 0p00@ , Z:s 0 @P 0 $ T z0(0@T c=@P80C,0 C R0P  R B   L H*< H L L H04 RQ `K B` T. s$  R  p @Q  0`E0000000400400HD0D00 OP_ p 0W3`0@s 0 >@PL 00C 0B ES D@hhHP <P 0@-MB( @Ѝ0/hhE-M@8P 01500 賟0S Cl#0 00~o0 5X @"R@ H S 2 0eo0 X4W3 @2 `0 R 0 PE `050rX; ?o [2l R kX2  (o 00S @,2 @$2 0 1R$ 0 P̱0S k!0 00n0 X @0150taX- n [ @1 @81  0 0R 0 hP 0 1500 H갰0S mk 0 00n0 _Xg @h 8gh'8gh@Hh8g[8g8g8gh"9ghP@-0@SP 020C00SЍ0C00 00M-0P<1@P(@Ѝ0 0 0(0$ Q %  R@ p @p@ ,pWO*0SS00  D ,0#0 0P0/o"X R,0<1K 0410p  0 G0 .0`0  0 p00p0` ,1S,! S0,1<1S< `0P `VQ ` V Q  Q ` `[o Z} 0  bE@Pc M-@PpK0`SP \S/S |P P0S /S\S0S  ERH|P0$  $0000000SR EP <|<[1 !  |P <1S |P 0 1 P! (0S00 00$00 0$000000000Sg_f@-@pM0S v|0to 0|@P L@pЍ  & @+@ހ0hg g!gg3gp@-\0M` h@P PP DPgeeeo0Ѝp@A-0Mp hPP @ `P@ 'P00 Ge v@P  @P0@H7e5e0Ѝ@M-HM@ pPtxp`jh0P 0 00Q Q0P0J  0P0A 00 Q A108V .UPU P@ 0P?0V0"0 0U PQ`V000`  U  00h0P 00d dHЍh"P@\0 S2 S0>T*0P0 0:0P  dPU  S0h d0 00 h00h0P@0 S2 S\1>T*`[ h 0P0 0 0  @Z h 0P P R" 0R .P*0 00`  h0 0 PU  h0lP@u0 S2 S0>Tl*`@Hg[g@-Mc8`P@P xЍqgA-p` dVgPP @ P  b:@P @PP ccp@-@` P*P -:z! 0000 !`pp@-@c@c/0@-lMP (@P0000 0lЍ0gp@-M , RR:ۍp@@PˍA`Ud @T @`@T` `  @U@`0M-00 4#ĠČ ȠĠP,Ƞ@8PPR&*p@P0.8S 0 @ ` 0 S0P#4S03 [0F`P @V `PЍ7@-  P@@@dQ@ Ѝ00 <`M-@ y` PpV Ѝ@~  0$(,R2 R/(  yP( $(,R:0Z0R0S ll`~ d 0[~XX W~ 0P4 8  T X \`YggfgggE-0M@ 0/R `)y/typP  @P&&~PG  y< PQBfy@P<P 02Et@P88~,~( ~ߍ00Pgf gp@- @PT  Q: c@P 00ll}h`}p 0  @  0R0@00Pgfgp@- @TpP P abp@^bP\bPPXb P: SM-b0@P - Sc0  Sd0  Sf0?0`ᬀ 0pJ㞕p0-00FV  @s0S00  s0S00  T0t0 00 0 Sl0  Ss0  S-0gM-0M 0/R `[xP01/xpP 0S7  PP1R}@G  Fx= @BBx@P=@ 03DPP1S 1}.}+}Pݍ00@0Z U}}}0U`| } 04 8 <  @ Xh<|TV  ( w0@ =0C%0$pt&0x'0|hp 0w44 0p4 8 0D?00042 83 ,Xn[0S -0,8 Č.0DȌ/0̌ RH:d0!C 0/S0!@0 T00 u t@`Tq 0Sn P/ p@P0i0k`ljpjWVP[[ qu꨺g-gźgfgE-M<8p\@ ,10%0[uPЍQ 0S  %\` `P00000S P 05/PP00 P00`00`0%L$u00 P0000`0%uꇲfVg8hgRfܰgM-@0 Mp0`0200 `M!PP u* *  Ѝ)0(`d*0h+0l0F S*0 $0(0,:0-,00 B40000 0jPP P P *`n00,000%t%PfQ:g@-$VPRP@M`HhDHh|HhP@-H0o`/M-$pM0@0  0并 0[@P@ 0jPlj`iVUpp PvtYY @ 0spЍ\\htUV Y0S @f 00` `0 08@0!0(pD 0Lp000801<0u" p@0P20p( 18 LD 8<0b" p@0p20(@203 4H080(0)0(p,t*0x+0|-0.0/010S S St0% p$  0sXX@X$08pẋpQz}H,p<㧋<0܋4؋pQpX d ̋Q Ƌo1SH긡帱Jd ᶋQ ᰋo1Jt0!0 X/4 0  ,  @!008!Pp  ps$0"s(s0800<0(0D 8L0! p@ (X02000EH 0t  00@0%|_sb(X0 (00!ZWHh*fggggg f gQ4f@fMgfg:g gWfKgp@-@` 0P@[P4UpHhA-@P0 `pFPP@ 8 p@00 s"@ Hh"fZgM-cP08M0,`0 0 :#:0X\@$ <rP8Ѝ0  0$PP  pp rP0Ӵ(`,0V 0 @rP`V000 0Z0 `@\"OJ0$J@#6P$F:J 00 ,0 & 60 0(Z`0 P`  Q(P,0VF0 P0%VZU*$@gPV 0[0 R0SE  WZPHHjr P P 00$10@ %0\rV$Wr(0`6/0 0 4:4PP u V[  )0( $*0(+0,[ *( (VV0 00P PHhgNfZgg0"fggPg/p@-@MP` P r0000 0`@P:qЍp4gfYg@-0@0S0 q0M00Hhg4/040 00,00,0/E-M8P`pᙴ@P <0JtS 000@ p`%0qЍffg@-4M`@Ppᴴ@P 400@p(%0qЍhfg@-P`ᵴ@P(00@`%0qЍpfOgA-p 0(`4 @8 P0@o//-T@-@P0P a^p PP4T046 Ѝ 0060 0 PPT `0 @ `` Tp0%_o"f9 g,0@-d@P P Dh@- Ѝp@-@P`0dUS0d0pSd0c00SPp@-@P WPp P@Hx00x| H00T0p@-|xx x | SL0A-`@p R @@T V-PQHh 0S/0 00!000!/Q0 R !  B ! /$M-0MPU \$ 0@S`PP P T0 Ad@P 000 00 pP 00 0] \0_4^ 8a `04b 8c <0e d04f 8g <09 804: 8; <00Q P04R 8S <40I H04J 8K <80Y X04Z 8[ <<0@0A 4B 8C <@0U T04V 8W  0=mЍ0bS0iS0`!S:Sp R h0 m0\ P  _\e    rm00S + p{bPPm 0P0076i>066=66{> 077=0H7L7u>P7T70X7\7v>`7d7}>0''77a.x0 x0|00& &0$6(60]00@0008000Į哮,0PQ ppXQᷮr!\:\g Rd  C4`@V CQ4p00Wpᛮ,<T 㲮 pp;00: 0 0@ 0h4?o24D5@e0;`04, 0 04,0'#5 0074| el pg%vR045US4045S4t0454?0U4tT5 U(1 !03 0#R$10C2r"0Cr!0CR0Ce0CVx4|d! V(1 !03 0#R$10C2r"0Cr!0CR0C0C W4;0L:0pD %0lp00Q0 :0 %0U 0E 90P0% kUwQrVp 0FmUtt4 c? 0%/ 4% %*%,%@ %8 |%l%t%0 d%!\%7 B=`0N( 0pxńuńP%T5h峃8Wp0L "pP707C4W  `PV570770 / R6 HH80%088040k`)P'P%P|#P!P!p70P`%0\ 0Vt$x4|$Հ4ՂpR' %^k `P ``P| 0 4SX`P 0SP7007000707 `P7& 070#201 R 00600%kfL4/0XĄpĔ\00H5l4(/ 08#00<5`t40c0Q 60%0j`hhl00P00005TP @⨂ 4P 0|50x%0 `$5` 50h5N? ` 505l!,"QB"` 0^lh0pt >`P!<%4t0C40Aa0 0 B0`P? ` =  `Pltd P.O`d`34 4 8 dPPd0 0 pd0 0`d0` 0<  < &V( e ( d <00<05%DjQPP z^ E `0LĔLAA?/\/2#! 0 0$  "   X(0707 PPfQ> C PP]&PP; $  !PP,$77[s PP\q PPX70 7& ppkeJ %PP xq4200%iPa}n`pP:xp`xP<*?%PAP `@V AP3qN lNjNd0S6 y300PP0$D$076&0 066 0 ppHN @0 ``@Np@fggfg8hgCfgJgcdgfg@-@P 0 NDhT0@-0@S  40  p RiHhHhg0@ RP/B"Q@-0 1 #0P Ѝ7@-t4P0c^@P @ 000 :rPP M@ Ѝ0M-g0M`  i`0ЍP p@`Q0P $R0(S0, }0|R~00ڠ Q 0 0$7`00 %h0S``xM0@000S S `hdV0l4) (04* 8+ <4- ,04. 8/ <4100 5$20(30,404687<&9 804: 8; < 4= <04> 8? <44@0A 4B 8C <@4E D04F 8G <0`0I H04J 8K (?,x&A@ $B(C, ED $F(G, I HpLtJ xK |M N O u yx $z({,&}| $~(,& $(,& $(,& $(,p' $(,t' $(,' $(,' $(,' PT X \T $(,$ `Pd Th lQ R S U V W Y X]ČZ Ȍ[ ̌\ $^(_Ą,$a `Čb Ȍc ěd $f(gĄ,$i hmČj Ȍk ̌l $n(oĄ,$qp u $r (s ,tČvȌw$̌Ą(u,(PP` PPp@ 060,%0yep{p0 0p0050%0cePnPTTT!$ $Ą ( 0$ $ $ $ 0$P $Q $R $S $T $U $V $W 0$p $q $r $s $t $u $v $w  0Q * P *0 s*0 R 40R40SdSt$B0唤 SPtS0V0SSxW00Z0SW00Z0SP$ |V00?PPL406050 5 00  S 0 0*68 S<S6S0VX00[0S6S$ $0|$0VQp'X00[0St7S&0V0 7X[X7S|&0Vx7WppZpWr4Sq  BSm0$S00Ӣ?h 4ĔR  /`^$Q\YdVWppT0 P M܄t   ` `V >:S=:;Sp:9 0000000%0d0000000 0 0 0 0 0000000000nfgkfigfgM-ĐL4  B00BC1 R@``BFa00BC1pfQ7vQ0 Q(1 !03 0#R$10C2r"0Cr!0CR0C4D0CT6 T(1 !3 #R$1N2r"Nr!NRN Q&$"H%!  BB1BqR(13 #R$1J2r"Jr!JRJQ Q(1 !3 #R$1H2rr!HRH  BB! RⰆ R(1P3 P#R$1PE2r"PEr E [ B\& \ Ƞ1P3 P#\ Ġ1PE2|  PE| E[LP P  1!' @ƀ @B"B. 01#ȱ ϬUA6Ķ  ϬS0ÏFo@P'ǀQpt0Q0qp00S0P07ǀЍpS p `@PQ 6 0C0 //p@-` 0P@ 0SV & BR R4&&0C0 PR p8^<^S  Qpp@-`Px@ 0 S pPUpƐ0L\1/-0\A1M-@ 0` 0S`PUtWtz W00 ?   PW@T@-}7'0 0/@S0 00z4$0R l00h%0ObЍW&4R(00(%0006fggg@-`pV@ Pb' N^00@-P`p[O@P $  `p0S 0@{0 R  R(00$%0Y]> Ѝfg 0 8 R0  /p@-@ PR B`0Q   RJ pp0 S B ppp@-@0` 0RP0Q  0 S pp0S0p pM- M@0 p  0`|먎0PP 0 10P %0EYU 0QPPE_oR  04 8 < S P Ѝ0X0 $0(0,ZX0 7  B: 04 8 <P=fg1A-P`UpwNPP @#   @PL@PP  =2p30 tW 8T@P0S@ @@@@OM-@0(p00P `PPЍP/  p00P 0 ^4\ 00 P P00CR P p0000 p P 00P4 0R0 dPP PA-0PS`  3@7p 0 @P@ T@P \ @P MP00000\ :/4\/!0@-C@ 000S0Q00000\:04\0(M-M0P@p0 p4R Xo᫲[ 0S0S X `0㖃#`D0S @ <P<@DHYM`P Ѝ0S P㤀Zpĕ0>S \! 0KC# 0Qa40>S] H+0Se [X 0?[_0 0S[40>SW00 0?[B 00S>40>S:0C#0Q40>S1 L @000 0!404!0C# 0000\5 IXK 0ZT0S,0@` 000L0S 0 [ C@ /0L Z K`` 000000S 80S`80  000 00 0HLP> 00000000 0!404!#8@#0<00@00D0#P`$0㤀娀嬀0A-P`UpgLPP @& 0 @P @ 9@PP y;2p30 tW 8R@P0S@ @@@@OM-@0M00味#P08 P _Z Z= <0S? `Zp p8 Z`Ve 00 p\ P=` 00PQ4 0RM08 P)PD P`I P 0 0p 00 p` 00CS0s ^p00P 0 #0 P 40R0S0O p@ 0@00S  2#D R@ </ R E-pP0@p000!D0<r`PJ   Ѝ0` XZ(p`@ 0!40C4!P0SJ 000 0!404! 0!000!0S pG'0C00V2`VXq0S0S 0 p? p``0S#<00@00D00堀 0!40C4!0S8'8H080pS`` JP y000 0!404! 0!000!@4hp@-P3,@T ,`8@@pM-P0`Sp 0 a p@ " 0 0 0S@ 0S08P  0 > p@ ЍP0>0CS0s p00P@ 0##0P40Q@ M- MPp 0@@`PG ?W 0#<@000,>0CS0+0; P%0 P  0 mP  W0 0< @000>0CS   Ѝ E-,M`P 0Hp@P !0 0 ` P$p-P ,ЍP0 0@ 000!D0<<`@PDp@- 0 @PP ~ Ѝ AP @-`0 @PPh Ѝp7 00 0`7P 0S0M p  P 0 `M-8Mp 0إP`s@P:T;7 0 @P@+0S0  p@ 0 T @0`0`000!D0<J<@pD@P# 8ЍT " 0 0(@,0p4l@P7 @0@@0@P ^-gM-P Mp0 R0P 0S0* p%0s p0 Pj0 2"0 P:4 \ : P: 1#4 0R@`0 0S0 @D00T0 0@0@j* 0S9 0C0 60P * b"00S:4 Q: S:0c#4 0R0  !D0<0P  0 0 Ѝ@ @M-0 pP`@P0S! T 2@P 7 00 0P@Ѝ0 T @0 DGP @ 00R 40>S 0  @P #6@M-2 M`p``` 0 p@pP!60 0  0P)0( *0+08003 204 08PP 5 Ѝ   PP500`0p@-P@U 0P 5U 0UP TY0!( 00C0!55p@4h@-0P^@ `p@T:`@V: P/-0S08 R0 S R -008SP0 /M-p`@P80ST0`T5P 0S0`G5P@M-0M@H( ,0FPP PR 0< 0000 00pF`P 0000 0pP55P404000p tpp4 WR '0$00SG CR4 0!404!0!#000!0P(000 0,000Ѝ Ls0 p0%41P00<0p0%'P0 0 000020%0P24pl4$ 0 0 $ 40Č0Ȍ0̌<000@ 0 $ 0( 0,0D 80P4\ 4\Ϝ0S0 100%O0Z ! %O0W3`5\SR, d0%dO\500%HO0R00R0S 0%O`50\500%O0l10H0P:40LS: x00 0%|O0S>0CS <00 0%HmO0D  p4hf_gggggZgg־ggZg@-@pM P`~ 00 0 P P 0Q R 00 008004%02OJЍ7fg@-h4@S %0Pxdddddx t N" ` ! X NЍ" < 8 4 , ( Nff|fffffff P0/Ḇff/M-@0HM00`?Q TN L0  0@OK0P(N 04 8N NQ>.!N 0 $ 0 ( 0,48 8NA @0C4B 8 NE D0G4F 8NI H0K4J h 8MM L0O4N H 8MT0U4 Ma0` e$b0c(d0,4f 8g 4 8^MA @0C4B  8UME D0G4F 8LMI0H M$J0K(L0,4N 8O<?8P ,R<SLI0H M$J0Y(L0K4NO8X ,Z<[$KA0@ E$B0U(D0C4FG8T ,V<WKa `0c4b 8Ke d0g4f 8Ki h0k4j h8Km l0o4n \8Ku t0w4v $8Ky x0{4z 8K 04 8K0Kq p0s4r 8KHЍ302` d000000c0K)0( -$*0+(,0,4.88/7@-p<QFA"JV3a@@P0a Ѝ0 >PP/0S@/d0SP/ RP/ /p@-@PP 0S00d0S  38 8 40 0 0$\ BX00/X0\ p P  p@-DT@H4SD4H6LpJPpPM-@P 0@@1R?08MD60h>P4 U D4Pf0H60VL6$a>000(`,0H4 R00|6 ~ pPup 00|6 1 pP`U`8Ѝp0 W0SL000 R 0 00 200%H$`4$, !$  P$  5 5$ 5 5( R$ #2X S    $ ! %`H048< 0C1(0(0 S 0(0p$娃0100P<,40=P5 ,40$Q@4@0,40 6  0 (00(006 00$0X2:0,0H60L6U8ЍM `D 0`dgKf-g0 CQ/ R /P/ 0S/!M-~^Pp`@T(Q=P " p!(0 0@@r 0S`` M-pM4e 0.=P PY 00$  PJpP@@'x<QP(*T< 0f@D0PE00 0@ Tp" 0fP@D00 0@p P, 008 00 4 8 <S@Kp0S 0@PKP4S0PЍ V TKP80P4`VJP1E-0$M0 0000004 00@qPP00 0hpPPX ` ( 0H; S, Q  AS9  S- Pa`%0GpW `%0FpW `%0F +;0S Q  Q r:0S Q:  AS,z/BP,4  D<P/ , )(04*8+<0#(0)##<*+0U+S+$ЍQ S40C 0C SSX $0H0Sʅ PKf>gggM- M0@0儤sd0 J@ 03<0 000@Py p`p  Ѝ00 0`pb0 Pp 04 8 <00`PJZ00l|$0 b0CALP 0tSP@0Sj 0t4 `C`0c`F 4$ B̿0 V0S 0 0004 7P;P 0P 0}N 0 @@0P`PJ0 RS00" x%E00X20X%0E plx$ 04 8 |40c@JP00 0Bup[|4 C0c@Jr Pq|$0 b0CAPf X00<1`0 8%0E`P0  t0S $00SK 0 '*00C00S=0U 0 @000*00C0Z.D000%<`E00 0` emf)gghggM- $ R8 (MRP 0 p p p`;0S 7̷  o :@P| 4 0CS 0p0 0JPJpp0  p 10% 0 Ep10%0E)`(Ѝ0 S 0L10P% 0D0 $0(0,048<SR 00%0D 04 8 <$0   g)$0  S *p000%\DQt` pK00 0`꟱fgg*gigfgp@-P~@T `$P y/)@Gp0@-0M>S,@( P S+ S \ @P ~)Ѝz0P @ `p0`wkP 0Q0 @0 ]P @A-~P#@T 0S(  0|&00p P Ѝ|6 1 052 3 4 $670(<0 0S" 0 P04 & p0( ,^ (, $!a`@$0`(@Q A0\0:///M- p` 0@R080P4C9P U0  00 0P0P"` P! {N"#"$# 0 @@0 A-302 0p4 P8 ~<9 S W00000%0CЍX1 00R0S@08`V8>X) (0-4* 8+ <, $.(/,Q :0GS 00p%0lg\gefggM-pM@c pP 0P0 01   pPU4 0CR  00>0%0(CPpЍ700}78'|f   0  pPup 7 0  pPU g{~J0Sp p`P7070S;  0 pK R -00 %B    $(,R Q  0`-0 L %B00,=00% B$K  $ (  $0(< 0P0:0S <0 %0B0p8080W(0S4 4R0040`V00S {>⼇<0 04040X<0,pg}`F0W:gp!R:;0 %0KR * x;0 %0DBP 10S S 0;0H %0$`0 0!004 8 < $"(#,`0 R]*ZZPZWSTt(0AO P 0 (0R SE*0`:0X %0 0 4 8  04 8 <00! 04" 8# <<40!"T7`P < O7 Pt&m P000400< < `{> 0'0 p-0S wO8(00  %AP04X80S~( d03 40S  S 0`00(0 000|6  (0  ppPv0000h 0 Ph r   (0 0`X0X0V(00 0C` 0C04 0C0!R:70x%0AA00(00l70h%06A$NP 10S<eeHeHee$010 5$2(34 $6(7 ,$ `  ]\ $^_0(,000! 00( 0 #PPy $ )(04*+ 8<6  0`0$ 0 $P9P0@0 08080D0302 $8T0)0(,*0+08-0.0/0\  000P00S0%/6PP \ )6\ 0PM%  8``(@8 P 80, Df80T !(<007 '0 `$0) (-* 0+ 5P , /$.(1,Č2Ȍ3̌46P7P J@DUZ ZP\P^ 30%0PP01l0`000h $ 0! h01 0( 430 0%('@ P+! $0 > CR(  PP  00 39 S S  PP7/``F40?:#: "&*:,#:0?(:#: 0!#6:0C "2`d hh `l0g00  o   90 pP 0 R$QS B0C0  0 ? pP0 d A PP`40S4<%P$0>0CS0&$0 0 000$0 `Cw 0 ``$ufgf:gg@gg8e8guggfgg[fgg;gp@-@mPPp60C6 0 PP#M-PPM  ML\ʂ\:Kx3?Sj A0 $0   0 6P 44 ?$0 $ B 0R ( ( `p@DT 0 c 00 0 M 0 5 ԸР20 5Zdh0a@ 0 `V 0 5P$  ౸ gff g g gH 0BS/$0@-A0`Q!V(P8@, ` pFW0`  B,H S$0S C1#  0M-PM,< 00 0,00 0$S 00C, BR 0,0@D@@@$0<00@0 0D00D080(020(004S80 L@@\ b04 Ġ1A$1 RQqd„P sM@ DP[ 8P`ŠPPKPE`8PPeVŌ[L$Z$Z JJQP4 a1$1U qUfbbFA B\`@ $<@ QT7`P[KP#  Z03# Jl0PQP0PP4P4p PPqHpqP41$1UU gr4`HP\p4`A BrGLBD\Ap@4 B Ġ1a$1ETf43   T4D1$1Š \\KnB0@@p\Q(PP4a Ġ1$1UUfbL B(PbF^`:@D ZpW䠑펒'\P Ġ1E4$1T Be@LRRETP4QD1$1Š a\ BKe DRRE\P@4Q Ġ1$1EaT Be@LRRETP4QD1$1Š a\ BKe DRRE\P@4Q Ġ1$1EaTe B@LRRETP4QD1$1Š a\Ke@AR BRE DQP)@ Q@aN 4@(@4P\Pa0PP4 Ġ1$1U@UfbL B(PbF@0P^a(PP(P @T@ @T*Z3 #$@ Q# PAUP!`[`#K`@D```(@@V@ @8: AP P``UbFL Ba @`@PЍ\@40p Ġ1`$1ET2f0TP4PD1$1Š \KaBAP[@K@# Z A @D BZ4 L  L\bF B```@4P Ġ1$1ETeL\RE BP@4 Ġ1P$1ETe…   BRE@LP  @DTN B4D1$1Š \KnB0@@N B D|@N\4 Ġ1$1 BP^ @ \4 Ġ1L$1^dBBD BLL@^ Q@41$1E aTe B@NRRETP Q4D1$1 a^Ke BRD@REPP^ Q A41$1Š \eR B NREqP(   J4\40(0H00,00<0 0$1@00 D0 0 Ġ1S00,$84, $0SH *0<S*h0R`0RH0  4`ppppWVM-,P4`\@rP 0 *QE*4Š ST*0sM@ p$PP(p@peW H$V\Q*Q"* Ġ4S"L 0C 1P\3#Q3\$`8PVpF(5#`\`p\*Q* Ġ4S"P11L 0C P!^ @`P 0Ca*Q*4Sc*3m`p^*Q*4Š S*bP\*Q*` Ġ4eS"L 0C 1 X:W N^䠑펒'`Q\p*Q*P Ġ4U`S`"L 0C 1?V@F^~ ^P|`nPE` A`\q*Q* Ġ4`SL 0C `"1PU`@ P0`0C*Qm*4S*p^*Q`*4S*Q # 3P #RN0CSm` ps@P``0C*QB*4S:@P0C*Q4*4S0C @ N^ 0C*Q$*4Š SR0_23S:[ 0CP NMPE\*Q* Ġ4 CN PU0C2M@Pu0 $0L H0X0,000P /M-`pPo,0@H0<#S 0S, 00 P%L0S VX0+ S\ Rf^0]8<`L 0_X 4 000$0 SW:H0S 0S0, 0Ѝ X 0 \ 0`F00S0(0S50(0S P0S  <2s>0  S(0D0@0<080040P0X XNV 00S F    P \⡳X`000, 00 P Z PP0 PC `F Pe 00X  V00S \0X  00P0 0[P Z 00P 0 B 0B0`HX@-@03/00p@-` 0LC0sNSP@ T0S 03/T@oppR/pp@- 0@4 8 < S:3 0PU *Q40#0 #10%Qp98@- P@`P P ЍpM-@[0xM00#00p0P` Pp00000 0 P0 R,  nxЍx@-4M p0C@` P$0j 0 S!0 AS\  |p0(0rh0,00 S3:S0 (000000 $0 p@004Ѝ|=et=eQ/3p@-@P' R`$QP!$0S0$0(0,Sx0(0 $03/0P @ 0 d  (`T P L ,0Ppppt>e>e,-00 ^ 0BSM-P5 @T2 0S/: 0PU, U0  ( R Sm:`00 0 R P  00`,@"<#14#`< 0 0C 0000 00C0 0000 R   0@@ʓ0^0 08P 0<0|0 Up GRT  2*P|PP(( Z8 P<P UPPEU! ^P@ S<0 0 00 R 0JS0 3: 880U80 優  RPPPPE U,Z P@$r Q<o  S J\ <ʠ00 Ƞ 0U80ȩ  \ PPLP\ "Z @TC Q< @ \ S PEQQP1000\80YQ QPAQ "  @Ą̠ QS LR<  2,00(( Q8 0p(!0 S 00CS 0<@0@@Q 08

0  P 0l=S   0S0C1 0 2> 0X[0  h<0S h<0|-h<  Rh<S 0P000 0S 0C2# 00(00CS00 0S&0C 013,0   0SC0 310%e,  P( R0z-e; Np,0\̿04040( S ⫼|0l`p00( S K0 ` Q 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R   { Qo 0 0000 00C0 0000 R   j QR 0 0000 00C0 0000 R   ^ Q5 0 0000 00C0 0000 R   N Q 0 0000 00C0 0000 R   > Q 0 0000 00C0 0000 R   . Q 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R   @ E P 0  0000 00C0 0000 R   Pz 0  000000C00000Q   P] 0 0000 00C0 0000 R    P@ 0 0000 00C0 0000 R   P# 0  000000C00000Q  (0Sʞx A0x \0Pp `s`!00 0S  0C2# 0000P0[400 P 0 0000 00C0 0000 R   000CS["00 0S 0C2# 0I #00 0S' 0C2# 0000000C00 P 0 0000 00C0 0000 R    P 0 0000 00C0 0000 R   400 30 0<` z S0V`PR-0 00`l00 `0=(0p%?40h<0X0$0C.T<0 Rz: <>  ` R`l*0!0CS,0S4:>$0=>01P$0p31,l  < ,<00  @010D LP0p$00 0S 0C2#U 0<01 SP%00 0S# 0C2# ⊠8 P 0 0000 00C0 0000 R    P 0 0000 00C0 0000 R    P 0 0000 00C0 0000 R    P 0 0000 00C0 0000 R   @0(10JSD 1 0SG000:|>0|>0|!@00@0(0S0S)T0SL<0p0C0T0SP,00p0C00ST0S 00CSz*|   |.\` A!1!> 000Q`|. |!@00@0(0SL<P,00pS 000 ,0S0z=<0$0=>010L0$031,l  < ,<00  @020D 00LP0C0(00 0St 0C2#U 0u<01 SP)00 0S 0C2# ⊠8 z{yzxywAL|sA#ʌ|00 k> 0|.0`FP9y|y <00C010 P||>0C|>S|.s 0z @h0< 0l0h0:=\l 0 0`d\sl\d\<A`FQ`Rs Pk 0 0000 00C0 0000 R   j PN 0 0000 00C0 0000 R   _@0-10JSD 1 0X0 SU R0H000H0 0SH00000S 000,0S%0z=<0$0=>010L0$031l<<00@020D00LP0C0H &00 0S; 0C2#U 0|<01 SiP'00 0SF 0C2# ⊠8 4 R00?e `,  C. 00D4 <0R=0!- R(0S =R0SP S40T,  2,((T  Pl0ᾀ0T C8 40P`0V8 @4> 00F80T,< 02!P(0( 8 @4 0R@400 S  00CS 0< !HT̔ HNH0HHN 80T,< 02!P(0( @48 0@4!!DĒ  D0DSL401 #4Pǿ80@$   1#80@AQ0#<01 #4800< @4 Q 0 0000 00C0 0000 R    P 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R    Qg 0 0000 00C0 0000 R    QJ 0 0000 00C0 0000 R    Q- 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R   r Q 0 0000 00C0 0000 R   b Q 0 0000 00C0 0000 R   R,g(epppH LhA-@ p P`U-A XPP^^%@00RP@0X S a 0R0S! b!0X`^PPPa`a@N`0C0 $ R/00#000 # @@0  P5 202> @PP@ `@Q@P>@ P *@@Q`҅ 䎀 @A@>(@CT,`DQ *!B \ L B  b S %0B00C <2결@{JXT @^@P@T@EX@㲠Ჰ@ T㲠`V$P. PpCp#  h# dC$ `#  UP!U!1p*  @/o"P *[RP3P"U xЍ@T x@ంT∀ᰢD`` $  * B(   A`@Pg:Th:@D$`@ @ @@A`0 45 @4 ``@0` [AGP@@@x@PDU@DH$HTDEQY ,@ Q)(@P@T$ RP A8PPlPU*PPFUP\P`P[VP3P"U~P@PQPaPHEQPP @``R ( \  p0a@A̠\ LPp @`P ! zf|f @T; 0S0S508` S 00 0 000000 R&4000   ,bP0`0U 0S`0   ,,`P0`0U 0S  0&$ 0   ,bP0`00; U 0@`S`0 P`000 & @0W1![ R P  A \  B B0   @0 pG 0C @0@0S(0@0000;d W J 0S  \ @ 0Q02@057[W0    m [pGE 0 000p(08`Sl0L00T0/>0T00 l0p0P060h000`d000h800P6cPE0 h0h R0*TL 0SWh 0pGePP PzPk6c0EaPC0XWP pGePPR6cPEFh50000S S>l0L0T 0/T0pl0 ` $0 Y 0P0$05fl `P  X X  d G0P04V004 WR9T0L0  R1AW 0pGeP06&aPE\!@ P0*hwW pGePW pGePP6c0E cPC 0 000p8`:ppp.xp't.pp\ WPJ Z  AA +AAPL,|, A Ppp^ AAM-0@0fPЍ 0 $"448#8% S@2@" p@% S @2@"00@0T#*P0X\0P0TpGp`0hl0 @`0Td0FS*[:U Ვ@pK 0  P*PpGp 0S  "<<0"$,Ġ0!,, !  R "Ġ "$ , R  ""$, R /PR $ ""$, s/// /PP P($// /0# $ (#4<0,Ġ#, #4 <0"S~@-0#L$L(#4@<@Ts "<Ġ< "$ 0,0ShTf:0#,Ġ, #4 < P\RZ,< <,Ġ 0 0PR3\J  < ,<,Ġ 0 0PR3T$\8 ,< <,Ġ0 0PR3P( Ġ  03#R3"Q\ $.̠ĎH. 03#R3 "/  p@- <Ġ<  000#3&Pp(,L d Lh,Ġ@ Up,L T LX,Ġ@ \ p($ "̠ĎH"$, Qppp0A-0` pP 0@\$#\(#4<PP 000ESeeP0@S   @0 ZS@p@-P`@q 0p@@-@P@@-@P@M-(p,P`P@W@! P  , 4 8,Ġ P 0V  PZ@ Ѝ @7@-@, T X,Ġ \T 00 Ѝ0@-Pp`@ p0 Ѝ@- @P 0#,,#4 <0S 0 0 0#,,#4 <0S ЍA- pP`@P X  , 4 8,Ġ !PV00Ѝ0#,,#4 <0S P 0#,,#4 <0S @-Pp`@ p0 Ѝ7@-x 0@PP 0S T 0P 0S0# $ (#4< Ѝ0'g!gs@-P0@`BP0 \ЍprgA-p@CPP.0`/SP  /P HPP @PT:T 0@/S  F/ P@@0DyPPp@-P@ p@A-pP@`PT Ѝ0SPV0S P0?0Spp @- 0P Ѝp@-@P Pp0p@ B0Asp@-@`P@P p7P LP@A-@Pp`U  @P  _0P@C@PE@@-@0( P  oЍ\gp@-P@`vPp P@ ppPp@-0@000ZЍ P p ,0`$0P////f.g g#g@-0#̠̌#4<'\. .<Dg@-@0P 0S0#L$L(#4@<@Ѝ@-@0P0 0S 00 0Ѝx 0/lf, 0@-P  ofggM-PMp& ?P@`( 07 R!`/V  RR  P   `P  Pp ЍrgA-Pp `l@TЍ0 0/S000SS   PV`T@rg@-l Rl(`l lPg@-0@P 0#$(#4<@0@-M P@0 0 0013 P Ѝ0!""$, !0S0@-0P Ѝ@-  0SЍ-L| "<<"$0,E-p0B0`P  0!0q1P:40S 2V@  Ѝ@M-(Pp7@P)` 0@nP@ 01 Q@R @P@PPЍ /@ @-8l x~P 0 lx $P@l@'igRQ/M-` A@ @@R H P 03/0 P [EPET  W DR@ЍPꫪl 0g  Pp@-@  P @P[ op PpPz 0  #p*gM-M`pP U@ @Pd ߍ[   !0PP!0P @:gA-`pP@TQ  0P`1@p@-@`P}{ 0 00  000p-P 0 /p@-PQ 0S@ 0p 0p@`'TQ `Q 00@UP 0 pLhA-@PPp L0 `0S.,P U'00LhM-@`P @p0S`0 0 0  0S   P0 000@LhM- M  H@p 0XP H'0Q`!`3 0S @0S0ZP 0K ss8 V A*'P000U0 00CPPEU  0 0sG[5 P@0W0C?o20S/ Z L0 :/P 0 L00 0!P 0"0D0 Ѝ00L 000S 0D 000V: P5@ 0W0R0S% 0S L0 !># ! @T ЍM P# pC'0 c5( > `!PCUC!c6Z 吺. 2SX>W U \;A?o20S PE (0 0@S U #g7g[7g7g_7gM-PMp@pt`@SP@;#@T5#@x 0R3!:  j Tp1 `Z@D04# 0V&0 .@S P00HCL PЍU0 1 U0000 0 8  `0 `  @0g gffM- MP@p@S`@"PU"P001(0 !(  01C Р0$0 $0 0P0m, $ ,0@Dp@P K T0@- R 0 R0#01 # 0 @PUS0 B0` 00#01R #0  ..  .. ꜋f@-A-`PQp@Y"`F0@P0T  T # 2RW :pW`0?@ OP@-O> g@-ap@-`P e@P    p@-@ W@ Pp@-P`@P  8p0 0 /ῷf@-@0P 0C40S *000C 꿷f 0 # BR /  0M-^ 0Hp0` @ VQ TЍV TPN UT0^ 03#0N2'*QZ@ 0C TO@ @@@A@P\ TPN @$ @$HU 2@PE\VPP0S pCQ@ P&U( `pW  pZ#!pPW ` `v@ @@T 0@C$0 0 S zE-@ $MPt` hp 0 @ S$Ѝ 0000S  0x gg B@-0 ^@ L QT^0@-@Y h @g(Pgg/0"0M-Phh`Ap @ \ X( ^T pt@U@@D3#VZ p^ >.pt00Ct0T>. <#p PEtP Dx0Mh0hA-@@\A PH\P`q\```L Q\0B C   @ A U`M-` "0F`h  p kP S( R:Z  B@k X * # R@e @e @ T T 3R0C `F  05 0P 0 yP@Ѝ r"p@U@Dp@-P`@P pg0p@-P`0P S# F 0 00CRP@@p ^Pp@- PPh@ Q0 0CS%0 0p0SCpt 0Sp/0p@-0l00`0h0@ @RP <H R DVpp@2p@-P00l00@0h0Upp@2S0 "2/7f2S 0"2/Ag0 tP/mPSP dP 0P//n0@STfXfXfXf,f<f4f / / / / / /p@-P`"@ B202pM-0`4p@PQ8 0ASfLff\ff fDff f fXf<fffff,f00 0@0 0PP0 000 0@00PP @0P JRPЍ0 _P000@P 0 @PP00@ 0 ` 0 ` 0 @PP 0 `}00 0 @yPP 0 `0 S   0 S l 0@0b0 S < 0 S R0000P ^  R{0000P ^o P_oRU@,fP PE_oR[ 0 001@[ 0 0!00C0 꿷fgM-0@p0P` 0 0PЍ0 0P M-0@0P`p 0 0 P 00 P Ѝp@-Pt2 E0CS 0@20pgA-P@Q`p0S 0CP0[0WURPE `20CS 0@20gM-2@P`p00 .R#R RB 0b0QL$B Qffff f f< f< ffff\RU ?R [R b^R00@^R |RW 7002p0CS 2 20000Ѝ b \Q ]Q   A0C0 R\12b @ sb `0 0)S 02 W00S0*R?Q0 0 C?Q0 0  PI0 x>Rfgf+f>f7@-P RRRRR0^0C?o2 2Z@W00S0SJHGo Ѝ0E- p\M@` P   0 000 u Ѝ0  PiPU00\0SR l@-0@ P R P @@   RQ @B/ῷf  @00S/@ Q/00S/ 0\ 0C  R/R/- 0^A \S  0 S00\0S / P0/-P^\S0 R0/R/0 0QB/p@-P@@0 SRpUp R0  \C/p@-PP @P@px0\/- ^ ^\ A0 R/^^ R A-p@-@P\`@T 0PS0PpP 0S00Php@-PU @0P  0pP@-@0S~ Q sb0A S/ P/0A-@p[`P WPU@H@ PEP P/0\/h0S 0h@-fP@h f@-/<# 0z Ѝ @-h0SeP0 heP 00O Ѝ6 g[ g/@-@@@-@H 22< 0B0#30 !4ׂCp@-`@P@P 0P:pp@- `@TP1P!@Tp耖%/ @-X0 %꠆-@-Vp@-!R!DP@0!6 !Ơ! 5A0Q0p0C0000p 03 1A0pQ0C0000pM-00À P$!Q *M.t .`  0!  J"r"p`""f ++#8  e B0  L! q  e` B0  L # !`F0``L0 B0 L L #GGŧM-`M†` Z& `p@P 2 S) r0Qp Z@D-p/ @D-p Zj J ` @` 2 .3.30@D+pp@D pQ: Z@D @D0000Q@D> W Up5P0S U003050ZPX0PX00E 0S  0 0 R$Z?@DP@D 00# Z Z@D-p  @S50 RZ?@DP@D 0 S50S50 BQ@0 0S ZQ 0  RZT`ЍR 75 S50]fA-R``Pp@j0 0 CP PP  LPTDS50 APP0D 0c@D0P@0 S 4 50R5 ꩇgM-@M` 0!0!#  0%0S  R V050Z030J50F@Ѝ%S V05P$-S 0S3 00C Sp&00C \+0.S0:00@ \ ࠓ,*P/@0 )P0+S S #S *S pPP@PP 1!0pA@pWpgP +0K00@ \˿hP LQZQ zQ tQ 0xSbS%S XS V%03050S Z0ƅFlQlPLc0CS\f4fffff4fffff fxf4fff ff8fff(f0  S50AQW0GWppg`p V@10405 10` FQWpGp`+ S50@P0  0 00 aS' ISJ MS w P!Pp!iS@ mS@P%!d, 0@:!SQ0S  0aP p00 0 P @P0, P p0 0 @P0@P4S,@0( $0( $0D@QS @.0A0F q PP LQ@0@ 0  PnH]lQ@ ZQ hQ0 S tQ 00 ? S!(A(? gf@-@YP8TD -@- 00M ЍЍ/0 E-@-   Ѝ Ѝ/@-AMM 0 @P AލЍ-@- ЍЍ/A-DP0@p0@P 0' S`A0ETh7@-P @P0o Ѝ07@-P@DP0o Ѝ000S0D   00xS00 0S000S 00/ῷf0 0 D  009S0CWC/ /ῷf@-P p@`@WU` Ѝ! 0@-0@pP`P Ѝ 0S R 0C0S R-\ @-`@-@ d0 00kS mS gS000iS  0 BR00迷fA-P sp`@@WUЍ6!!`@-@ |0 00kS mS gS  000iS  0  BR00迷fQp@-P@D0AU*P Q P0C Tp@]UTp迷f 0M-X'ڤ0PHOBDEA`Cp dpQQZpp@0JE$80 1@ 0@QmfT0p@-`@PdQQDop:gA-p!22[.B"B[(BB 0`0`#3`0&hD1 h@@v$9 1{10R0 QESEPEU%0`00 `PUJ V0   0 0.50 @D< 20@D0@ 0Hd1Q+o[PJrQmQ ųM- p@p`83v%V1S00"0 w"QP Bw(y`p@-P`3V1Sp00p(@@C0 00 "0 0S yw 0Ay`w0SA-p@p`2RS R w P BLwgy`0S# @@F$0 P  R 0S0w 0AHy`3VVwA-P`(p80@- R(1S iELFg)g0 00( 0$ 0 00 00/hhhhhhM-鴀`p  @ P`   d` w  w w   pvЍMh*g!ip@-X`XPX 0L@0#  <00S000 p@h!i!ih!i@f+gx0P/@-<` `00@SH@00S0400(0 hhhjf!iRM-PM ЍM0 @4 S0 4SXpW0S  ` v 0R0 4 S  S) ЍH! 00000 0P@lv  hv 0 cv _vP pYvЍMWp0S  Lv00Z`P  ?vu0P`P P@;/ 1v10000,f!i!ihhhphh 0P/hM-Pc9}5RS @ @  ""$, 6  B B@B S #,,#4 <02   C, C( C$ 0@PiP iP]0000@40@^0p0pp5iP'<00` u7 0         B?PЍpfffA-@`T(QQPQ3 30A R,S3f3f2f3f42f42f42f2f2f42f42f42f42f42f42f2f3fQ3f2f42f3f42f42f3f42f42f42f42f42f 3f42f42f2f42fd3f  QuP@  Up 0 cp 8u00?Upژ@0 R?p㄀ t0 h \0XPp uP1f!i!i!iffh'fhhhhiis@- `@t \0RTP00_0 lY0 l,Ѝp@QЍpcSchM-M8PUPPCSPDQPU0@S0S0S 0  0t 3#0SЍ PZ 0 t2 R0 R 5R@0SP t0S  t|2 ttl20 l@P L20S@+00S $  vt00 2 ЍM>R 0 0ЍMG ^PP Rt0S apW W Wl@``@P!tH+!0@0000`P!4!(",$$ "$%  Pt0 8t   t  t 0 BD0C PPX:' Ne NX8'AgBg BgBgBgBg&Bg-Bg4Bg;BgBBgJBgRBgZBgbBgjBgrBgzBgBgBgBgBgBgBgBgBgBgBgBgBgBgBgf7yg?ygޭfff}xgxgxgxgxgxgxgxgqg gqg gqgffSg\gf$g2g@g{]gf]gfff]ggggggg͂g݂ggggggmg ggbxb8aajm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-fKgKgYgff8(Hgcgtgggggȃgكgggg$g6gGgYgjg}gg߈gXgYgYgYgNg,Yg>YgNYg^YgggggXwgiygtyg bbpbxbNaheaNaPaxPaPaT`PaPa`f cLPaXc2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      u-boot*EHCI Host Controller*print_cpuinfomv_phy_88e1121_init__of_translate_addressfdt_fixup_memory_banksdo_bootvx_fdtraw_accessubi_remove_volusb_setup_descriptordev_get_parent_privdevice_remove__put_mtd_deviceallocate_partitionverify_bbt_descrnand_transfer_oobself_check_aiubi_detach_mtd_devcheck_avubi_open_volumeubi_eba_initubi_self_check_all_ffwl_get_wleubi_dump_flash__mvgbe_mdio_readphy_device_create_ehci_create_int_queueread_blockubifs_read_nodetake_gc_lnumvalidate_sbvalidate_masterubifs_scanubifs_tnc_read_nodedo_kill_orphansreplay_budfs_devreaddev_get_uclass_privadd_mtd_devicecreate_bbtnand_scan_taillate_analysisuif_initcheck_attaching_infoubi_resize_volumeubi_io_read_vid_hdrubi_wl_get_peb__mvgbe_mdio_writedo_readpageubifs_read_node_wbufinit_constants_sbubifs_read_superblockscan_for_masterubifs_scanned_corruptionread_znodeget_cs_sqnumvalidate_refnand_fill_oobvalidate_vid_hdrself_check_in_wl_treeubifs_finddirnand_detectself_check_vid_hdrubi_wl_put_pebubifs_lsself_check_peb_vid_hdrdo_workcrypto_comp_decompressvalidate_ec_hdrubi_do_workerubifs_decompressself_check_ec_hdrself_check_peb_ec_hdrubi_io_writeself_check_not_badubi_io_readdev_get_privcheck_corruptionautoresizeinit_volumesubi_io_read_ec_hdrubi_wl_init__mvgbe_sendubifs_readinit_constants_earlyubifs_read_masterread_pnodeubifs_start_scanubifs_recover_log_lebreplay_log_lebdev_get_uclass_platscan_pebio_initprocess_lvolself_check_volumeubi_io_mark_bad__mvgbe_recvubifs_sizeubifs_check_nodemount_ubifsubifs_read_nnodeubifs_scan_a_nodeubifs_recover_lebubifs_replay_journaldev_get_parent_platearly_erase_pebubi_attach_mtd_devubi_read_volume_tableubi_create_volumeubi_io_is_badubi_wl_scrub_pebubifs_is_mappedfree_orphanscheck_lpt_crctry_read_nodeubifs_recover_master_nodeubifs_validate_entryfdt_find_or_add_subnodedev_get_platubi_early_get_pebvtbl_checkdo_sync_erasewear_leveling_workervalidate_inodecheck_lpt_typeubifs_update_one_lpinsert_old_idxdevice_probevalidate_vid_hdrself_vtbl_checktorture_pebself_check_ecubifs_leb_unmapubifs_igetubifs_change_one_lpadd_to_listnor_erase_preparesync_eraseubifs_calc_lpt_geomnand_waitubi_add_to_avubi_io_sync_eraseerase_workerfilldirnand_select_chipubi_compare_lebsself_check_writeself_check_in_pqubifs_printdirubifs_leb_read%s: Bad cell count for %s drivers/mtd/mtdcore.cBUG at %s:%d/%s()! BUG!(((((AAAAAABBBBBB## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue %s: unlock failed, writes may not work fixed-partitionsread-onlydrivers/mtd/ubi/attach.cmemory allocation error while creating partitions for "%s" mtd: partition "%s" is out of reach -- disabled mtd: partition "%s" extends beyond the end of device "%s" -- size truncated to %#llx drivers/mtd/mtdpart.cWARNING at %s:%d/%s()! mtd: partition "%s" doesn't start on an erase block boundary -- force read-only mtd: partition "%s" doesn't end on an erase block -- force read-only DRAM: sysrstdelaysysrstcmdarch_numberTLB addrirq_spsp start bad length %d < %d ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again Hit any key to stop autoboot: %2d  0%2d *?[\Resetting CPU ... %-12s= 0x%0*lx %-12s= 0x%.*llx Unknown operator '%s' ERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s write %s write: device %d block # %lu, count %lu ... %ld blocks written: %s ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** UBI** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") (none) IDE device %d: Device %d: unknown device changed to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u initcall sequence %p failed at call %p (err=%d) ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryregno-map## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeWrong Ramdisk Image Format ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image ## Loading init Ramdisk from multi component Legacy Image at %08lx ... (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... image is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failedbootdelaykernel-offsetkernaddrrootdisk-offsetrootaddr%s.%sUnknown uclass '%s' in label Unknown seq %d for label '%s' part_%xwhole.bootdevMissing bootstd device boot_targetsExpected at most %d bootdevs, but overflowed with boot_target '%s' Scanning bootdev '%s': No more bootdevs ** Booting bootflow '%s' with %s Boot failed (err=%d) Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Automatic boot of image at addr 0x%08lX ... bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] BZIP2 internal error %d UBIFS error (ubi%d:%d pid %d): %s: invalid crc in LPT node: crc %hx calc %hx UBIFS error (ubi%d:%d pid %d): %s: invalid type (%d) in LPT node type %d bootsecure%*s## Error: Secure boot command not specified ## Error: "%s" returned (code %d) xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected No UBIFS volume mounted! %s - %s Usage: %s - No additional help available. Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\...y Y yes YES %.*s%s%d,%dSunMonTueWedThuFriSatSunMonTueWedThuFriSatunknown node(%lu, %s)inode(%lu, %s, %#08x)(%lu, %s, %u)datatruncate(bad key type: %#08x, %#08x)bad key format %dbootcmd=setenv bootargs ${console} ${mtdparts} ${bootargs_root}; ubi part root; ubifsmount ubi:rootfs; ubifsload 0x800000 ${kernel}; ubifsload 0x700000 ${fdt}; ubifsumount; fdt addr 0x700000; fdt resize; fdt chosen; bootz 0x800000 - 0x700000bootdelay=3baudrate=115200loadaddr=0x800000mtdids=nand0=orion_nandmtdparts=mtdparts=orion_nand:896K(uboot),128K(uboot_env),-@1M(root)console=console=ttyS0,115200mtdids=nand0=orion_nandkernel=/boot/zImagefdt=/boot/guruplug-server-plus.dtbbootargs_root=ubi.mtd=2 root=ubi0:rootfs rootfstype=ubifs rwRemoving MTD device #%d (%s) with use count %d Error when deleting partition "%s" (%d) %s: null device (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Supports 48-bit addressing Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available unbind() method failed on dev '%s' on error path Failed to unbind dev '%s' on error path device '%s' failed to unbind invalid mtd device '%.*s' partition size too small (%llx) no closing ) found in partition name empty partition name no partitions allowed after a fill-up partition unexpected character '%c' at the end of partition out of memory 0x%08llx@0x%08llxunexpected character '%c' at the end of device %s: Device '%s' failed to remove on error path %s: Device '%s' failed to remove, but children are gone %s: Device '%s' failed child_post_remove()U-Boot.armbootp_archbootp_vciDHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d 0123456789ABCDEFEHCI failed: timeout when disabling periodic list , Build: %sextlinux/extlinux.confCore: %d devices, %d uclasses, devicetree: %sVirtual root driver already exists! Virtual root driver does not exist! Some drivers failed to bind bootstdbootstd_drvbootmeth_Some drivers were not found tick-timer(not set)boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit current eth = %s ethaddr%-12s= %s IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s bootcmd## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Flags not supported: enable CONFIG_BOOTFLOW_FULL Out of memory Trying to execute a command out of order ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... filesize## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified bootfilehost:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... no partition id specified partition changed to %s%d,%d List of available devices: %-8s %08x %c%c data abort unknown Cannot find RTC: err=%d Reset RTC... ## Failed to set date after RTC reset ## Bad date format ## Set date failed: err=%d ## Get date failed Date: %4d-%02d-%02d (%sday) Time: %2d:%02d:%02d -n## Resetting to default environment edit: setenv## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed Environment size: %d/%ld bytes ## Error: "%s" not defined usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr

" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s fast interrupt request Unable to update property %s:%s, err=%s ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX res Reset IDE: ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded BUNZIP2 ERROR %d - image not loaded fileaddrInvalid data width specifier ### filesystem type is %s uImageJFFS2### %s loading '%s' to 0x%lx ### %s load complete: %d bytes loaded to 0x%lx ### %s LOAD ERROR<%x> for %s! Can't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... PHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x Base Address: 0x%08lx byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Zero length ??? crc32FDXHDX10010fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sdelall device %s%d <%s>, # parts = %d #: name size offset mask_flags %2d: %-20s0x%08llx 0x%08llx %d no partitions defined active partition: %s%d,%d - (%s) 0x%08llx @ 0x%08llx could not get current partition info defaults: mtdids : %s mtdparts: addno such device %s defined in mtdids variable too long partition description %s:%s(%s)%sgenerated mtdparts too long, resetting to null delcurrent partition deleted, resetting current to 0 partition %s not found quiet no devices available Device %d bad blocks: %08llx erasescrubclean-y.spread.part.chip NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .oobNo memory for page buffer Error (%d) reading page %08lx Page %08lx dump: OOB: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x .raw.raw.noverifysize adjusted to 0x%llx (%d bad blocks) %s: error at offset %llx, ret %d Unknown nand command suffix '%s'. %zu bytes %s: %s markbadblock 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad biterrToo many pages in one erase block bit position 0 to 7 is allowed Error (%d) nand_erase_nand page %08llx Flip data at 0x%lx with xor 0x%02x (bit=%d) to value=0x%02x Error (%d) write page %08lx Not a NAND device bootdevice ** No boot device ** ** Device %d not available activeeth%d : %s %pM %s ping failed; host %s is not alive host %s is alive prefetch abort resetting ... ** Abort software interrupt ## Executing script at %08lx ubi%d error: %s: cannot erase PEB %d, error %d ubi%d error: %s: cannot erase PEB %d ubi%d error: %s: cannot erase PEB %d (emulated) dynamicstaticSettCleardetachError, no UBI device selected! Device %d: %s, MTD partition %s UBI: MTD device name: "%s" UBI: MTD device size: %llu MiB UBI: physical eraseblock size: %d bytes (%d KiB) UBI: logical eraseblock size: %d bytes UBI: number of good PEBs: %d UBI: number of bad PEBs: %d UBI: smallest flash I/O unit: %d UBI: VID header offset: %d (aligned %d) UBI: data offset: %d UBI: max. allowed volumes: %d UBI: wear-leveling threshold: %d UBI: number of internal volumes: %d UBI: number of user volumes: %d UBI: available PEBs: %d UBI: total number of reserved PEBs: %d UBI: number of PEBs reserved for bad PEB handling: %d UBI: max/mean erase counter: %d/%d -numeric%d: %s Error, no volume name passed create--skipcheckIncorrect type No space left in UBI device! Name too long! verify_mkvol_req failed %d Creating %s volume %s of size %lld removeRemove UBI volume %s (id %d) It's read-only mode Error changing Vol tabel record err=%x UBI: reserve more %d PEBs ubi%d error: %s: cannot remove volume %s, error %d %sing skip_check on volume %s Please see usage %lld bytes written to volume %s UBIFS not mounted, use ubifs mount to mount volume first! UBIFS not mounted, use ubifsmount to mount volume first! ** File not found %s ** undefined instruction starting USB... resetting USB... stopserialstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. storgcc (Debian 12.2.0-14+deb12u1) 12.2.0 GNU ld (GNU Binutils for Debian) 2.40 ubi%d error: %s: work failed with error code %d nc%2u %2u-%2u = %5u %sEHCI fail timeout STS_ASS reset marvell,armada-3700-ehcimarvell,ac5-ehciEHCI fail to reset USB EHCI %x.%02x EHCI failed to shut down host controller. unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error Timeout poll on interrupt endpoint out of buffer pointers (%zu bytes left) RE is too long (code overflow)EHCI failed: timeout when enabling periodic list .callbacks${...}${.flags## Warning: Unknown environment variable access method '%c' ## Warning: Unknown environment variable type '%c' ## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" arocsdxbimautostartbootm_lowbootm_mapsizebootm_sizeenv_buf [%u bytes] too small for value of "%s" mtdpartsbad CRCCannot import environment: errno = %d import failedLoading Environment from %s... readenv() failedFAILED! NANDErasing %s... Writing to %s... %s=%s ## Error: cannot export environment not initialized Failed (%d) Saving Environment to %s... not possible *** Warning - %s, using default environment  ubi%d error: %s: read EC is %lld, should be %d ubi%d error: %s: erase counter overflow at PEB %d, EC %llu ubi%d error: %s: failed to erase PEB %d, error %d ubi%d error: %s: bad physical eraseblock %d detected ubi%d error: %s: no reserved/available physical eraseblocks ubi%d: mark PEB %d as bad ubi%d: %d PEBs left in the reserve %s%daddr%saddr%pM%s.%dethactethrotatenoethprimeeth%d: %s [PRIME]eth%dmacskipethmacskip Error: eth device name "%s" has a space! eth_bootdevDT Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s address not set. Error: %s address %pM illegal value Warning: %s failed to set MAC address Failed to iterate over directory %s < ? > %10u %s ** Can not find directory. ** UBIFS error (ubi%d:%d pid %d): %s: cannot read node type %d from LEB %d:%d, error %d Error: FAT sector size mismatch (fs=%hu, dev=%lu) Error: FAT cluster size not set Error: FAT cluster size too big (cs=%u, max=%u) ** Unable to read file %s ** U%02X%02X-%02X%02X#address-cellsfdt_chosen: %s WARNING: could not set bootargs %s. 2023.01+dfsg-2+deb12u3u-boot,versionWARNING: could not set u-boot,version %s. ERROR: - must RESET the board to recover. %s: %s: %s /aliasesetherneteth%daddrlocal-mac-address%s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. linux,phandlefdt_initrd: %s linux,initrd-startlinux,initrd-endWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. #size-cellsrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dokayNo valid device tree binary found at %p No current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster => no partition number specified unexpected trailing character '%c' no such device %s%d no such partition Jump offset is too bigoutbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02xUBIFS error (ubi%d:%d pid %d): %s: orphan list not empty at unmount missing environment variable: %s ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part %s/ %s %8lld %s %d file(s), %d dir(s) Unknown ArchitectureUnknown CompressionUnknown OSUnknown Image%d Bytes = %4d-%02d-%02d %2d:%02d:%02d UTC %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done Cannot find console unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) Error: Invalid FAT entry: 0x%08x %u Warning: MTD name "%s" is not unique! %s%dDevice %s not found! Base path too long (%s%s) Retrieving file: %s Could not initialize timer (err %d) Could not read count from timer (err %d) Error: Bad gzipped data Error: gunzip out of data in header Expected include path: %.*s Couldn't retrieve %s pxe_label_overrideMissing override pxe label: %s Missing default: %s ### ERROR ### Please RESET the board ### CRC32 for %08lx ... %08lx ==> %08lx 0123456789abcdef %0*lxEnv export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it!      Bus %d: ** Timeout ** not available OK blk#%dide_blkNo Powersaving mode %X IDE read: device %d not ready Error (no IRQ) dev %d blk %lx: status %#02x XIP %s %s Loading Uncompressing %s Unimplemented compression type %d ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC Unknown image format! %sImage Name: %.*s %sCreated: %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x ERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconf - must RESET the board to recover. Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command mtddevnummtddevnameunknown compression methodincorrect header checkunknown header flags setinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkinvalid distance too far backinvalid distance codeinvalid literal/length codebaudrateload-environmentNAND: %lu MiB Net: add_node: malloc failed add_node failed! UBIFS error (ubi%d:%d pid %d): %s: old idx added twice! %s=%s%d.%d.%d.%dget_fl_mem: unknown device type, using raw offset! ** ERROR ** %*.*s has dup version =%s %08x Compression: %s frag count: %d compressed sum: %d uncompressed sum: %d load: Failed to find inode has dup version (resolve) = load: Failed to resolve inode structure UNKNOWN COMPRESSION METHOD = load: Failed to read inode ls: Failed to scan jffs2 file structure find_inode failed for name=%.3s %.3s %.2d %.2d:%.2d:%.2d %d %s %8ld %s %s -> Scanning JFFS2 FS: offset %08x already seen, skip . OOPS Cleanmarker has bad size %d != %zu OOPS Padding has bad size %d < %zu Unknown node type: %x len %d offset 0x%x %s: Failed to scan JFFSv2 file structure  done. spi-nandonenandinvalid partition number %d for device %s%d (%s) .dtb./bootmlocalcmdNo kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxkernel_addr_rSkipping %s for failure retrieving kernel ipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s malloc fail (FIT address) fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdt_addrfdtcontroladdr%s: %s list passed to list_sort() too long for efficiency No match for driver '%s' compatibleDevice tree error at node '%s' Error binding driver '%s': %d ERROR: Failed to allocate 0x%lx bytes below 0x%lx. lmb_dump_all: %s.cnt = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes %s ## Total Size = 0x%08x = %d Bytes LZO  prebootNo CLI availableunknown cmd (%d) at %d ## ERROR: unsupported match method: 0x%02x Cannot add window '%04x:%04x', conflicts with another window %s: %x - %s <--> %s %s is not a known ethernet mdio_register: non unique device name '%s' %llug%llum%lluk%lluEnter choice: PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex NULL device name! MII devices: '%s' Current device: '%s' No such device: %s PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T xwr%08lx: %08x %0lx %04x %02x ? JanFebMarAprMayJunJulAugSepOctNovDecJanFebMarAprMayJunJulAugSepOctNovDecnot same typ %d != %d Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx incorrect device type in %s incorrect device number in %s Minimum partition size 4kiB, %lldB requested No closing ')' found in partition name Empty partition name No partitions allowed after a fill-up Unexpected character '%c' in mtdparts Not enough space to save partitions meta-data Partition size must be a multiple of %d "%s" partitions still in use, can't delete them Wrong mtdparts: %s MTD name too long: %s Could not find a valid device for %s Could not parse device %s Failed parsing MTD partitions from mtdparts! Failed parsing MTD %s OF partitions! nand0=orion_nandmtdparts=orion_nand:896K(uboot),128K(uboot_env),-@1M(root)mtdidsmtdids too long (> %d) mtdparts variable not set, see 'help mtdparts' mtdparts too long (> %d) mtdids: incorrect mtdids: no identifier device id %s%d redefined, please correct mtdids variable could not initialise device list mtdparts=device %s%d redefined, please correct mtdparts variable mtdparts_init: no valid partitions Err..%s could not read PHY dev address 88E1121 Initialized on %s Error: RTC in 12 hour mode, can't determine AM/PM. Error: RTC did not increment. Warning: Only century %d supported. marvell,kirkwood-eth-portfixed-linkfull-duplexFailed to allocate MDIO bus Err..(%s) Dropping packet spread on multiple descriptors Err..(%s) Dropping packet with errors Non-aligned data too large (%d) Err..(%s) in xmit packet phy_connect failed EPTGMKnand_bbt: can't scan flash and build the RAM-based BBT JEDECCould not find valid JEDEC parameter page; aborting UVY ZZ YVUe03f %s:%dblk_partitionCould not find "%s" partition Couldn't find partition %s %s ** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x ** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** Whole Disk## Unknown partition table type %x Partition Map for IDESATAUSBMMCHOSTNVMePV BLOCKVirtIOEFIUNKNOWN device %d -- Partition Type: %s Part Start Sector Num Sectors UUID Type ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s hdusbdmmcsdxx%s%c%dcannot add second partition at offset 0 %s: offset %08llx beyond flash size %08llx %s%d: partition (%s) size too big %s: partitioning exceeds flash size %s%d: partition (%s) start offsetalignment incorrect %s%d: partition (%s) size alignment incorrect %s%d: partition (%s) start offset alignment incorrect ZCould not get PHY for %s: addr %d %s:%d is connected to %s. Reconnecting to %s (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed PHY reset timed out A1A0Z0Error.. %s:Unsupported Kirkwood SoC 88F%04x SoC: Kirkwood 88F%04x_%s fdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%s%llu Hz%s%lu.%ld %cHz%s Boot Extd%3d %-10lu %-10lu %08x-%02x %02x%s%s %u Bytes%s %ciB%subi%d error: %s: self-check failed for PEB %d, EC %d, Protect queue Error parsing config file invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** UBIFS error (ubi%d:%d pid %d): %s: bad data node (block %u, inode %lu) FAT32 FAT12 FAT16 ncipncoutportncinport^%s$Error compiling regex: %s egiga0egiga1HUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command Invalid OOB size valueubi%d error: %s: bad magic %#08x, must be %#08x ubi%d error: %s: self-check failed for PEB %d ubi%d error: %s: self-check failed for PEB %d, EC %d, RB-tree %p ubi%d error: %s: bad CRC, calculated %#08x, read %#08x ubi%d error: %s: bad VID header magic %#08x at PEB %d, must be %#08x ubi%d error: %s: no volume info, but volume exists ubi%d error: %s: self-check failed for volume %d ubi%d error: %s: bad alignment ubi%d error: %s: alignment is not multiple of min I/O unit ubi%d error: %s: bad data_pad, has to be %lld ubi%d error: %s: update marker and corrupted simultaneously ubi%d error: %s: too large reserved_pebs ubi%d error: %s: bad usable_leb_size, has to be %lld ubi%d error: %s: too long volume name, max is %d ubi%d error: %s: bad name_len %lld ubi%d error: %s: corrupted dynamic volume ubi%d error: %s: bad used_ebs ubi%d error: %s: bad last_eb_bytes ubi%d error: %s: bad used_bytes ubi%d error: %s: bad skip_check ubi%d error: %s: volume info is different Device %d: %s%s: readonly variableWorking FDT set to %lx fdtaddr (effective reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: (%0*x) %0*x Err..(%s) Invalid PHY address %d Err..(%s) Invalid register offset %d Err..(%s) SMI read ready timeout Err..(%s) Invalid phy address Err..(%s) Invalid register offset Error: SMI busy timeout In: No input devices available! Out: No output devices available! Err: No error devices available! RE is too long (data overflow)USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32menutitledefaultpromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedarchitecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIefiEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vloadaddrbootmethu-boot,boot-std/boot/bootmeth_distrou-boot,distro-syslinuxresetPerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]print monitor, compiler and linker versionbootflowBoot flowsscansourcerun script from memorybdinfoprint Board Info structureblkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigurebootzboot Linux zImage image from memoryconinfoprint console devices and informationdateget/set/reset date & time[MMDDhhmm[[CC]YY][.ss]] date reset - without arguments: print date & time - with numeric argument: set the system date & time - with 'reset' argument: reset the RTCSunMonTuesWednesThursFriSaturecho args to console[-n] [args..] - echo args to console; -n suppresses newlinebootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsfatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeflattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structdiskbootboot from IDE deviceloadAddr dev:partIDE sub-systemreset - reset IDE controller ide info - show available IDE devices ide device [dev] - show or set current device ide part [dev] - print partition table of one or all IDE devices ide read addr blk# cnt ide write addr blk# cnt - read/write `cnt' blocks starting at block `blk#' to/from memory address `addr'itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=fsinfoprint information about filesystems[ directory ]load binary file from a filesystem image[ off ] [ filename ] - load binary file from flash bank with offset 'off'load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'halfworddouble wordloopinfinite loop on address range[.b, .w, .l, .q] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmwmemory write (fill)[.b, .w, .l, .q] address value [count]nmmemory modify (constant address)[.b, .w, .l, .q] addressmmmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]MII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablemdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)define flash/nand partitionschpartchange active partition of a MTD devicepart-id - change active partition (e.g. part-id = nand0,1) of a MTD devicenbootboot from NAND device[partition] | [[[loadAddr] dev] offset]NAND sub-systemNET sub-systemlist - list available devices listpingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoltruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-z-eubiubi commandsdetach - detach ubi from a mtd partition ubi part [part] [offset] - Show or set current partition (with optional VID header offset) ubi info [l[ayout]] - Display volume and ubi layout information ubi list [flags] - print the list of volumes ubi list [flags] - set environment variable to the list of volumes (flags can be -numeric) ubi check volumename - check if volumename exists ubi create[vol] volume [size] [type] [id] [--skipcheck] - create volume name with size ('-' for maximum available size) ubi write[vol] address volume size - Write volume from address with size ubi write.part address volume size [fullsize] - Write part of a volume from address ubi read[vol] address volume [size] - Read volume to address with size ubi remove[vol] volume - Remove volume ubi skipcheck volume on/off - Set or clear skip_check flag in volume header [Legends] volume: character name size: specified in bytes type: s[tatic] or d[ynamic] (default=dynamic)ubifsloadload file from an UBIFS filesystem [bytes] - load file 'filename' to address 'addr'ubifslslist files in a directory[directory] - list files in a 'directory' (default '/')ubifsumountunmount UBIFS volume - unmount current volumeubifsmount - mount 'volume-name' volume1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'imxtractextract a part of a multi-imagerunrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintsaveexistssaveenvsave environment variables to persistent storageshowvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodoneusb_hubusb-hubusb_mass_storageusb-mass-storageBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access fileDOSISOscsisatanvmeefiloadervirtiopvblock/clocks/firmwarerootroot_drivernopsimple_bussimple-bussimple-mfdphy-handlephy-devicesgmii-2500qsgmiirmiirgmiirgmii-idrgmii-rxidrgmii-txidrtbi1000base-x2500base-xrxauisfiinternal25g-auixlaui4caui2caui4NC-SI10gbase-rusxgmiiToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMD/SpansionMacronixEonSanDiskIntelATOUnknownTC58NVG0S3E 1G 3.3V 8-bitTC58NVG2S0F 4G 3.3V 8-bitTC58NVG2S0H 4G 3.3V 8-bitTC58NVG3S0F 8G 3.3V 8-bitTC58NVG5D2 32G 3.3V 8-bitTC58NVG6D2 64G 3.3V 8-bitSDTNRGAMA 64G 3.3V 8-bitH27UBG8T2BTR-BC 32G 3.3V 8-bitH27UCG8T2ATR-BC 64G 3.3V 8-bitH27QCG8T2E5R‐BCF 64G 3.3V 8-bitNAND 4MiB 5V 8-bitNAND 4MiB 3,3V 8-bitNAND 8MiB 3,3V 8-bitNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitNAND 4GiB 1,8V 8-bitNAND 4GiB 3,3V 8-bitNAND 4GiB 1,8V 16-bitNAND 4GiB 3,3V 16-bitNAND 8GiB 1,8V 8-bitNAND 8GiB 3,3V 8-bitNAND 8GiB 1,8V 16-bitNAND 8GiB 3,3V 16-bitNAND 16GiB 1,8V 8-bitNAND 16GiB 3,3V 8-bitNAND 16GiB 1,8V 16-bitNAND 16GiB 3,3V 16-bitNAND 32GiB 1,8V 8-bitNAND 32GiB 3,3V 8-bitNAND 32GiB 1,8V 16-bitNAND 32GiB 3,3V 16-bitNAND 64GiB 1,8V 8-bitNAND 64GiB 3,3V 8-bitNAND 64GiB 1,8V 16-bitNAND 64GiB 3,3V 16-bitmvgbemarvell,kirkwood-ethGeneric PHYorion_timermarvell,orion-timermarvell,armada-370-timermarvell,armada-xp-timerrtc-mvmarvell,kirkwood-rtcmarvell,orion-rtcusb_dev_genericu-boot,bootdev-usbehci_mvebumarvell,orion-ehcifatext4ubifsunsupportedNONEZERORTIMERUBINMIPSCOPYDYNRUBINZLIBzlibdeflatenot categorizeddirtyfreeemptyfreeable0 (GC)1 (base)2 (data)commit restingbackground commit requestedcommit requiredBACKGROUND commit runningcommit running and requiredbroken commitinode nodedata nodedirentry nodexentry nodetruncate nodepadding nodesuperblock nodemaster nodereference nodeindexing nodecommit start nodeorphan nodeno node groupin node grouplast of node groupdirentryxentryFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGSseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcjedec,spi-norsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspallwinner,sun4i-a10-nandaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-initu-boot,bootdev-ethnvlansyntax error FATFAT32blksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) fromTFTP %s server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx Retry count exceeded %s; starting again clock-frequencyCould not get ECC infoHUSH_VERSION0.01ubi%d error: %s: two LEBs with same sequence number %llu ubi%d error: %s: 'ubi_io_read_ec_hdr()' returned unknown code %d ubi%d error: %s: this UBI version is %d, image version is %d ubi%d error: %s: erase counter overflow, max is %d ubi%d error: %s: bad image sequence number %d in PEB %d, expected %d ubi%d error: %s: PEB %d contains corrupted VID header, and the data does not contain all 0xFF ubi%d error: %s: this may be a non-UBI PEB or a severe VID header corruption which requires manual inspection hexdump of PEB %d offset %d, length %dubi%d error: %s: 'ubi_io_read_vid_hdr()' returned unknown code %d ubi%d: "delete" compatible internal volume %d:%d found, will remove it ubi%d: read-only compatible internal volume %d:%d found, switch to read-only mode ubi%d: "preserve" compatible internal volume %d:%d found ubi%d error: %s: incompatible internal volume %d:%d found ubi%d: scanning is finished ubi%d error: %s: %d PEBs are corrupted and preserved Corrupted PEBs are:ubi%d error: %s: too many corrupted PEBs, refusing ubi%d: empty MTD device detected ubi%d error: %s: MTD device is not UBI-formatted and possibly contains non-UBI data - refusing it ubi%d error: %s: bad is_empty flag ubi%d error: %s: negative values ubi%d error: %s: bad vol_id ubi%d error: %s: highest_vol_id is %d, but vol_id %d is there ubi%d error: %s: bad vol_type ubi%d error: %s: bad data_pad ubi%d error: %s: bad ai->min_ec (%d), %d found ubi%d error: %s: bad ai->max_ec (%d), %d found ubi%d error: %s: too high PEB number %d, total PEBs %d ubi%d error: %s: bad lnum or used_ebs ubi%d error: %s: non-zero used_ebs ubi%d error: %s: incorrect highest_lnum or lnum ubi%d error: %s: bad leb_count, %d objects in the tree ubi%d error: %s: bad highest_lnum ubi%d error: %s: bad ai->vols_found %d, should be %d ubi%d error: %s: VID header is not OK (%d) ubi%d error: %s: bad sqnum %llu ubi%d error: %s: bad vol_id %d ubi%d error: %s: bad compat %d ubi%d error: %s: bad lnum %d ubi%d error: %s: bad used_ebs %d ubi%d error: %s: bad data_pad %d ubi%d error: %s: bad highest_lnum %d ubi%d error: %s: bad last_data_size %d ubi%d error: %s: PEB %d is not referred ubi%d error: %s: bad attaching information about LEB %d ubi%d error: %s: bad attaching information about volume %d ubi%d error: %s: mtd%d is already attached to ubi%d ubi%d error: %s: refuse attaching mtd%d - it is already emulated on top of UBI ubi%d error: %s: only %d UBI devices may be created ubi%d error: %s: already exists ubi%d: attaching mtd%d ubi%d error: %s: multiple regions, not implemented ubi%d error: %s: min. I/O unit (%d) is not power of 2 ubi%d error: %s: bad write buffer size %d for %d min. I/O unit ubi%d error: %s: unaligned VID header shift %d ubi%d error: %s: bad VID header (%d) or data offsets (%d) ubi%d: MTD device %d is write-protected, attach in read-only mode ubi%d error: %s: failed to attach mtd%d, error %d ubi%d error: %s: cannot clean auto-resize flag for volume %d ubi%d error: %s: cannot auto-resize volume %d ubi%d: volume %d ("%s") re-sized from %d to %d LEBs ubi%dubi%d error: %s: cannot add volume %d ubi%d error: %s: cannot initialize UBI %s, error %d ubi%d error: %s: cannot spawn "%s", error %d ubi%d: attached mtd%d (name "%s", size %llu MiB) ubi%d: PEB size: %d bytes (%d KiB), LEB size: %d bytes ubi%d: min./max. I/O unit sizes: %d/%d, sub-page size %d ubi%d: VID header offset: %d (aligned %d), data offset: %d ubi%d: good PEBs: %d, bad PEBs: %d, corrupted PEBs: %d ubi%d: user volume: %d, internal volumes: %d, max. volumes count: %d ubi%d: max/mean erase counter: %d/%d, WL threshold: %d, image sequence number: %u ubi%d: available PEBs: %d, total reserved PEBs: %d, PEBs reserved for bad PEB handling: %d ubi%d error: %s: self-check failed drivers/mtd/ubi/vtbl.cubi%d error: %s: unsupported on-flash UBI format ubi%d error: %s: VID of PEB %d header is bad, but it was OK earlier, err %d ubi%d error: %s: volume %d already exists ubi%d error: %s: volume "%s" exists (ID %d) ubi%d error: %s: not enough PEBs, only %d available ubi%d error: %s: cannot create volume %d, error %d ubi%d error: %s: out of volume IDs ubi%d error: %s: %s reference count %d, destroy anyway ubi%d: detaching mtd%d ubi%d: mtd%d is detached ubi%d error: %s: %s: work failed with error code %d eraseblock attaching information dump: ec %d pnum %d lnum %d scrub %d sqnum %llu Volume attaching information dump: vol_id %d highest_lnum %d leb_count %d compat %d vol_type %d used_ebs %d last_data_size %d data_pad %d Erase counter header dump: magic %#08x version %d ec %llu vid_hdr_offset %d data_offset %d image_seq %d hdr_crc %#08x erase counter header hexdump: ubi%d: dumping %d bytes of data from PEB %d, offset %d Volume identifier header dump: magic %08x version %d vol_type %d copy_flag %d compat %d vol_id %d lnum %d data_size %d used_ebs %d data_pad %d sqnum %llu hdr_crc %08x Volume identifier header hexdump: Volume information dump: vol_id %d reserved_pebs %d alignment %d data_pad %d vol_type %d name_len %d usable_leb_size %d used_ebs %d used_bytes %lld last_eb_bytes %d corrupted %d upd_marker %d skip_check %d name %s 1st 5 characters of name: %c%c%c%c%c Volume table record %d dump: name NULL crc %#08x ubi%d error: %s: erase counter overflow at PEB %d, EC %d ubi%d error: %s: no free eraseblocks ubi%d error: %s: no enough physical eraseblocks (%d, need %d) ubi%d: force data checking ubi%d: recover PEB %d, move data to PEB %d ubi%d: data was successfully recovered ubi%d: try again ubi%d: try another PEB Volume %s not found! UBI error: too many MTD devices, maximum is %d UBI error: cannot open mtd %s, error %d UBI error: cannot attach mtd%d UBI error: cannot initialize UBI, error %d ubi%d error: %s: error %d while checking if PEB %d is bad ubi%d error: %s: read-only mode ubi%d error: %s: cannot mark PEB %d bad, error %d (ECC error)ubi%d: fixable bit-flip detected at PEB %d ubi%d error: %s: error %d%s while reading %d bytes from PEB %d:%d, read %zd bytes ubi%d error: %s: validation failed for PEB %d ubi%d error: %s: cannot invalidate PEB %d, write returned %d ubi%d: run torture test for PEB %d ubi%d error: %s: erased PEB %d, but a non-0xFF byte found ubi%d error: %s: pattern %x checking failed for PEB %d ubi%d: PEB %d passed torture test, do not mark it as bad ubi%d error: %s: read problems on freshly erased PEB %d, must be bad ubi%d error: %s: bad VID header CRC at PEB %d, calculated %#08x, read %#08x ubi%d error: %s: cannot write %d bytes to PEB %d:%d (emulated) ubi%d error: %s: cannot allocate memory to check writes ubi%d error: %s: self-check failed for PEB %d:%d, len %d ubi%d: data differ at position %d ubi%d: hex dump of the original buffer from %d to %d ubi%d: hex dump of the read buffer from %d to %d ubi%d error: %s: error %d while writing %d bytes to PEB %d:%d, written %zd bytes UBI error: too many parameters, max. is %d UBI error: parameter "%s" is too long, max. is %d UBI error: too many arguments at "%s" UBI error: incorrect bytes count: "%s" UBI error: bad value for max_beb_per1024 parameter: %sUBI error: bad value for ubi_num parameter: %subi%d error: %s: cannot open device %d, volume %d, error %d UBI partition '%s' already selected Partition %s not found! %s,%sUBI init error %d Please check, if the correct MTD partition is used (size big enough?) ubi%d error: %s: the layout volume was not found ubi%d error: %s: too many LEBs (%d) in layout volume ubi%d: volume table was restored ubi%d error: %s: both volume tables are corrupted ubi%d error: %s: more than one auto-resize volume (%d and %d) layout volumeubi%d error: %s: not enough PEBs, required %d, available %d ubi%d error: %s: %d PEBs are corrupted and not used ubi%d error: %s: found %d volumes while attaching, maximum is %d + %d ubi%d error: %s: too large volume ID %d found ubi%d: finish volume %d removal ubi%d error: %s: bad attaching information, error %d ubi%d error: %s: too small size %d, %d LEBs contain data ubi%d error: %s: not enough PEBs: requested %d, available %d ubi%d error: %s: cannot allocate memory to check for 0xFFs ubi%d error: %s: err %d while reading %d bytes from PEB %d:%d, read %zd bytes ubi%d error: %s: flash region at PEB %d:%d, length %d does not contain all 0xFF bytes ubi%d: hex dump of the %d-%d region ubi%d: reserved more %d PEBs for bad PEB handling size > volume size! Aborting! Cannot start volume update Couldnt or partially wrote data updatingdamaged volume, update marker is setNo size specified -> Using max size (%lld) Read %zu bytes from volume %s to %p read from corrupted volume %dNO MEM read err %x ubi%d error: %s: new PEB %d does not contain all 0xFF bytes ubi_bgt%ddubi%d error: %s: PEB %d not found ubi%d: schedule PEB %d for scrubbing UBIFS error (ubi%d:%d pid %d): %s: too few LPT LEBs UBIFS error (ubi%d:%d pid %d): %s: LPT ltab too big UBIFS error (ubi%d:%d pid %d): %s: cannot change properties of LEB %d, error %d UBIFS error (ubi%d:%d pid %d): %s: bad magic %#08x, expected %#08x UBIFS error (ubi%d:%d pid %d): %s: bad node type %d UBIFS error (ubi%d:%d pid %d): %s: bad CRC: calculated %#08x, read %#08x UBIFS error (ubi%d:%d pid %d): %s: bad node length %d UBIFS error (ubi%d:%d pid %d): %s: bad node at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: invalid compression type %d UBIFS error (ubi%d:%d pid %d): %s: %s compression is not compiled in UBIFS error (ubi%d:%d pid %d): %s: cannot decompress %d bytes, compressor %s, error %d unknownR5unknown/invalid name hashsimpleunknown/invalid formatNot a node, first %zu bytes: magic %#x crc %#x node_type %d (%s) group_type %d (%s) sqnum %llu len %u pad_len %u key_hash %d (%s) key_fmt %d (%s) flags %#x big_lpt %u space_fixup %u min_io_size %u leb_size %u leb_cnt %u max_leb_cnt %u max_bud_bytes %llu log_lebs %u lpt_lebs %u orph_lebs %u jhead_cnt %u fanout %u lsave_cnt %u default_compr %u rp_size %llu rp_uid %u rp_gid %u fmt_version %u time_gran %u UUID %pUB highest_inum %llu commit number %llu log_lnum %u root_lnum %u root_offs %u root_len %u gc_lnum %u ihead_lnum %u ihead_offs %u index_size %llu lpt_lnum %u lpt_offs %u nhead_lnum %u nhead_offs %u ltab_lnum %u ltab_offs %u lsave_lnum %u lsave_offs %u lscan_lnum %u empty_lebs %u idx_lebs %u total_free %llu total_dirty %llu total_used %llu total_dead %llu total_dark %llu lnum %u offs %u jhead %u key %s creat_sqnum %llu size %llu nlink %u atime %lld.%u mtime %lld.%u ctime %lld.%u uid %u gid %u mode %u xattr_cnt %u xattr_size %u xattr_names %u compr_type %#x data len %u inum %llu type %d nlen %d name (bad name length, not printing, bad or corrupted node) size %u compr_typ %d data size %d data: inum %u old_size %llu new_size %llu child_cnt %d level %d Branches: %d: LEB %d:%d len %d key %s last node flag %llu %d orphan inode numbers: ino %llu node type %d was not recognized (pid %d) dumping pnode: address %zx parent %zx cnext %zx flags %lu iip %d level %d num %d %d: free %d dirty %d flags %d lnum %d znode %p, LEB %d:%d len %d parent %p iip %d level %d child_cnt %d flags %lx zbranches: %d: znode %p LEB %d:%d len %d key %s %d: LNC %p LEB %d:%d len %d key %s %s: Error, no memory for malloc! Symlink recursion, aborting %s/%sUBIFS error (ubi%d:%d pid %d): %s: error %d reading pnode at %d:%d UBIFS error (ubi%d:%d pid %d): %s: calc num: %d UBIFS error (ubi%d:%d pid %d): %s: inode is too large (%lld) UBIFS error (ubi%d:%d pid %d): %s: unknown compression type %d UBIFS error (ubi%d:%d pid %d): %s: inode %lu validation failed, error %d UBIFS error (ubi%d:%d pid %d): %s: failed to read inode %lu, error %d UBIFS error (ubi%d:%d pid %d): %s: ubi_is_mapped failed for LEB %d, error %d UBIFS error (ubi%d:%d pid %d): %s: reading %d bytes from LEB %d:%d failed, error %d UBIFS error (ubi%d:%d pid %d): %s: unmap LEB %d failed, error %d Loading file '%s' to addr 0x%08x... Done UBIFS error (ubi%d:%d pid %d): %s: current fanout %d, branch count %d UBIFS error (ubi%d:%d pid %d): %s: max levels %d, znode level %d UBIFS error (ubi%d:%d pid %d): %s: bad branch %d UBIFS error (ubi%d:%d pid %d): %s: bad key type at slot %d: %d UBIFS error (ubi%d:%d pid %d): %s: bad target node (type %d) length (%d) UBIFS error (ubi%d:%d pid %d): %s: have to be %d UBIFS error (ubi%d:%d pid %d): %s: have to be in range of %d-%d UBIFS error (ubi%d:%d pid %d): %s: bad key order (keys %d and %d) UBIFS error (ubi%d:%d pid %d): %s: keys %d and %d are not hashed but equivalent UBIFS error (ubi%d:%d pid %d): %s: bad indexing node at LEB %d:%d, error %d other %s: Error in ubifs_iget(), ino=%lld ret=%p! %9lld %24.24s UBIFS error (ubi%d:%d pid %d): %s: cannot find next direntry, error %d UBI volumeUBIFS error (pid: %d): cannot open "%s", error %d UBIFS: only ro mode in U-Boot allowed. UBIFS error (ubi%d:%d pid %d): %s: too small LEBs (%d bytes), min. is %d bytes UBIFS error (ubi%d:%d pid %d): %s: too few LEBs (%d), min. is %d UBIFS error (ubi%d:%d pid %d): %s: bad min. I/O size %d UBIFS error (ubi%d:%d pid %d): %s: bad write buffer size %d for %d min. I/O unit UBIFS error (ubi%d:%d pid %d): %s: can't format empty UBI volume: read-only %s UBIFS error (ubi%d:%d pid %d): %s: cannot mount read-write - read-only media UBIFS error (ubi%d:%d pid %d): %s: 'compressor "%s" is not compiled in UBIFS error (ubi%d:%d pid %d): %s: too small LEB size %d, at least %d needed UBIFS error (ubi%d:%d pid %d): %s: too small log %d LEBs, required min. %d LEBs ubifs_bgt%d_%dUBIFS error (ubi%d:%d pid %d): %s: no LEB for GC UBIFS error (ubi%d:%d pid %d): %s: invalid node type %d in orphan area at %d:%d UBIFS error (ubi%d:%d pid %d): %s: out of order commit number %llu in orphan node at %d:%d ubifs: Error offset must be a multiple of %d ubifs: Error offset (%lld) > file-size (%lld) %s: Error, malloc fails! UBIFS error (ubi%d:%d pid %d): %s: cannot read page %lu of inode %lu, error %d Error reading file '%s' UBIFS error (ubi%d:%d pid %d): %s: unexpected node type %d master LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad leb_cnt on master node UBIFS error (ubi%d:%d pid %d): %s: bad master node at offset %d error %d UBIFS error (ubi%d:%d pid %d): %s: error %d reading nnode at %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad node type (%d but expected %d) UBIFS error (ubi%d:%d pid %d): %s: expected node type %d UBIFS error (ubi%d:%d pid %d): %s: bad node length %d, expected %d UBIFS error (ubi%d:%d pid %d): %s: bad node at LEB %d:%d, LEB mapping status %d No UBIFS filesystem found! UBIFS error (ubi%d:%d pid %d): %s: on-flash format version is w%d/r%d, but software only supports up to version w%d/r%d UBIFS error (ubi%d:%d pid %d): %s: on-flash format version %d is not supported UBIFS error (ubi%d:%d pid %d): %s: unsupported key format UBIFS error (ubi%d:%d pid %d): %s: min. I/O unit mismatch: %d in superblock, %d real UBIFS error (ubi%d:%d pid %d): %s: LEB size mismatch: %d in superblock, %d real UBIFS error (ubi%d:%d pid %d): %s: bad LEB count: %d in superblock, %d on UBI volume, %d minimum required UBIFS error (ubi%d:%d pid %d): %s: max. LEB count %d less than LEB count %d UBIFS error (ubi%d:%d pid %d): %s: too small journal (%lld bytes), must be at least %lld bytes UBIFS error (ubi%d:%d pid %d): %s: too large journal size (%lld bytes), only %lld bytes available in the main area UBIFS error (ubi%d:%d pid %d): %s: bad superblock, error %d UBIFS error (ubi%d:%d pid %d): %s: unexpected return value %d UBIFS error (ubi%d:%d pid %d): %s: corrupt empty space LEB %d:%d, corruption starts at %d UBIFS error (ubi%d:%d pid %d): %s: corruption %d UBIFS error (ubi%d:%d pid %d): %s: Not a valid node UBIFS error (ubi%d:%d pid %d): %s: Node a CS node, type is %d UBIFS error (ubi%d:%d pid %d): %s: CS node cmt_no %llu != current cmt_no %llu UBIFS error (ubi%d:%d pid %d): %s: failed to get CS sqnum UBIFS error (ubi%d:%d pid %d): %s: unrecoverable log corruption in LEB %d UBIFS error (ubi%d:%d pid %d): %s: failed to recover master node UBIFS error (ubi%d:%d pid %d): %s: dumping first master node UBIFS error (ubi%d:%d pid %d): %s: dumping second master node UBIFS error (ubi%d:%d pid %d): %s: bad index head LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: first log node at LEB %d:%d is not CS node UBIFS error (ubi%d:%d pid %d): %s: first CS node at LEB %d:%d has wrong commit number %llu expected %llu UBIFS error (ubi%d:%d pid %d): %s: first node is not at zero offset UBIFS error (ubi%d:%d pid %d): %s: file system's life ended UBIFS error (ubi%d:%d pid %d): %s: bad sqnum %llu, commit sqnum %llu UBIFS error (ubi%d:%d pid %d): %s: bud at LEB %d:%d was already referred UBIFS error (ubi%d:%d pid %d): %s: unexpected node in log UBIFS error (ubi%d:%d pid %d): %s: log error detected while replaying the log at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: no UBIFS nodes found at the log head LEB %d:%d, possibly corrupted UBIFS error (ubi%d:%d pid %d): %s: bad truncation node UBIFS error (ubi%d:%d pid %d): %s: unexpected node type %d in bud LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad node is at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: garbage UBIFS error (ubi%d:%d pid %d): %s: bad node UBIFS error (ubi%d:%d pid %d): %s: unknown UBIFS error (ubi%d:%d pid %d): %s: empty space starts at non-aligned offset %d UBIFS error (ubi%d:%d pid %d): %s: corrupt empty space at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: LEB %d scanning failed UBIFS error (ubi%d:%d pid %d): %s: LEB %d scanning failed, error %d UBIFS error (ubi%d:%d pid %d): %s: bad pad node at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad padding length %d - %d UBIFS error (ubi%d:%d pid %d): %s: corruption at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: first %d bytes from LEB %d:%d %s: Error reading inode %ld! UBIFS error (ubi%d:%d pid %d): %s: cannot read %d bytes from LEB %d:%d, error %d UBIFS error (ubi%d:%d pid %d): %s: bad key in node at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: cannot update properties of LEB %d, error %d directory entryextended attribute entryUBIFS error (ubi%d:%d pid %d): %s: bad %s node UBIFS error (ubi%d:%d pid %d): %s: bad key type %d Error reading superblock on volume '%s' errno=%d! Unmounting UBIFS volume %s! ( w usb,device-classusb,interface-classHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlySelf Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d String: "%s"Error: Cannot find high speed parent of usb-1 device See InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudiounable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times cannot reset port %i!? Bus %s: Port not available. probe failed, error %d No working controllers found lun%dusb_storage_blkusb_bootdevscanning bus %s for devices... No USB Device found %d USB Device(s) found generic_bus_%x_dev_%xusb_dev_generic_drvusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX selecting invalid interface %d%s: invalid max packet size Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) 12 Mb/s+- %s (%s, %dmA) %s %s %s %s Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ubi%d error: %s: node with incompatible UBI version found: this UBI version is %d, image version is %d ubi%d error: %s: bad VID header offset %d, expected %d ubi%d error: %s: bad data offset %d, expected %d ubi%d error: %s: bad erase counter %lld ubi%d error: %s: bad EC header ubi%d error: %s: inconsistent vol_id ubi%d error: %s: inconsistent vol_type ubi%d error: %s: inconsistent used_ebs ubi%d error: %s: inconsistent data_pad ubi%d error: %s: inconsistent VID header at PEB %d ubi%d error: %s: bad copy_flag ubi%d error: %s: bad compat ubi%d error: %s: zero used_ebs ubi%d error: %s: zero data_size ubi%d error: %s: bad data_size ubi%d error: %s: too high lnum ubi%d error: %s: non-zero data CRC ubi%d error: %s: non-zero data_size ubi%d error: %s: zero data_size of copy ubi%d error: %s: bad VID header drivers/mtd/nand/raw/nand_bbt.cU-Boot 2023.01+dfsg-2+deb12u3 (Jun 22 2026 - 08:38:07 +0000) Marvell-GuruPlugubi%d error: %s: bad CRC at record %u: %#08x, not %#08x ubi%d error: %s: bad data_pad, has to be %d ubi%d error: %s: too large reserved_pebs %d, good PEBs %d ubi%d error: %s: volumes %d and %d have the same name "%s" ubi%d error: %s: volume table check failed: record %d, error %d ubi%d error: %s: error %d while reading VID header from PEB %d ubi%d error: %s: too many erroneous eraseblocks (%d) ubi%d: scrubbed PEB %d (LEB %d:%d), data moved to PEB %d ubi%d error: %s: error %d while moving PEB %d to PEB %d ubi%d error: %s: error %d while moving PEB %d (LEB %d:%d) to PEB %d No space left to write bad block table ERROR : xmalloc failed ERROR : xrealloc failed Unknown errorloadxy_timeout1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d  [`\`[`0X`[`[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OSf\a-g-gMg\a-g-gEg\a-g-gff\a -g-gMg\a@-g-gMg\a-g-gMg\a-g-gNg\a-g-gY)g\a-g-g Og\aXl`-g-gscan - boot first available bootflow [addr] - run script starting at addr - A valid image header must be presentOg|a r`-g-gOg|aq`-g-g[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead  /addr [-c] [-q] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.@ - list partition table mtdparts delall - delete all partitions mtdparts del part-id - delete partition (e.g. part-id = nand0,1) mtdparts add [@] [] [ro] - add partition mtdparts default - reset partition table to defaults ----- this command uses three environment variables: 'partition' - keeps current partition identifier partition := := ,part_num 'mtdids' - linux kernel mtd device id <-> u-boot device id mapping mtdids=[,,...] := = := 'nand'|'nor'|'onenand'|'spi-nand' := mtd device number, 0... := unique device tag used by linux kernel to find mtd device (mtd->name) 'mtdparts' - partition list mtdparts=mtdparts=[;...] := :[,...] := unique device tag used by linux kernel to find mtd device (mtd->name) := [@][][] := standard linux memsize OR '-' to denote all remaining space := partition start offset within the device := '(' NAME ')' := when set to 'ro' makes partition read-only (not used, passed to kernel)info - show available NAND devices nand device [dev] - show or set current device nand read - addr off|partition size nand write - addr off|partition size read/write 'size' bytes starting at offset 'off' to/from memory address 'addr', skipping bad blocks. nand read.raw - addr off|partition [count] nand write.raw[.noverify] - addr off|partition [count] Use read.raw/write.raw to avoid ECC and access the flash as-is. nand erase[.spread] [clean] off size - erase 'size' bytes from offset 'off' With '.spread', erase enough for given file size, otherwise, 'size' includes skipped bad blocks. nand erase.part [clean] partition - erase entire mtd partition' nand erase.chip [clean] - erase entire chip' nand bad - show bad blocks nand dump[.oob] off - dump page nand scrub [-y] off size | scrub.part partition | scrub.chip really clean NAND erasing bad blocks (UNSAFE) nand markbad off [...] - mark bad block(s) at offset (UNSAFE) nand biterr off bit - make a bit error at offset and bit position (UNSAFE)jg|a`-g-gaddr part [dest] - extract from legacy image at and copy to default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] Bg|a(&a-g-g(wg |a a-g-g/wg|a(a-g-g4wg|aH*a-g-g;wg|ah#a-g-gBwg \a"a-g-gtg \aa-g-gHwg|ad!a-g-g/g |a)a-g-gMwg|a&a-g-gGg$xg8)xg.xg Jg3xg7xg =xg ,g Cxg Fxg TaTa(VaVaTa8VaUatTaPVa@VaUa`hVaHVaac`VaUa0VaXVahUaUa|Taa,aa`l `TaTahh(h(h0h0h8h8h@h@hHhHhPhPhXhXh`h`hhhhhphphxhxhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh h h(h(h0h0h8h8h@h@hHhHhPhPhXhXh`h`hhhhhphphxhxhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh h h(h(h0h0h8h8h@h@hHhHhPhPhXhXh`h`hhhhhphphxhxhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh h h(h(h0h0h8h8h@h@hHhHhPhPhXhXh`h`hhhhhphphxhxhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh h h/g/g/gp hhNyg#4 h#8 h# 4 h# 8 h1tbBBbt02zgf:zgfBzgJzgSzg [zgdzgȐf,jzg\fqzgf~zg$fzgEzgzgzgzgzgѐv@zgܐ&vzgܐ&vzgӐ&v {gה2vV ('{gޔvV (A{gEޔvP@ @(Z{gהt  (y{gޔt ({gBJ@ @ 8{gk {g {g {g {g {g3@ |gs@#|gC@:|gS@Q|g5 @g|gu @}|gE @|gU @|g6@@|gv@@|gF@@|gV@@}gx@}g9@}gy@3}gr@3}gI@K}gt@K}gY@c}gq@|g@|g@|g@|g@|g@|g@|g@|g@|g@}g}g}g3}gK}g3}gz}gc}g}g}g}g}g}g~g~g4~gI~g_~gu~g~g~g~g~g~g~g g!g 6g Kg ag wg@g:@g*@gJ@gg<g,gL+gAg>Wg.ngN0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N()*+,-./0123456789:;<=>?&,Fh,Fhgcc\ceserial0c4cc|cçcHc4cccccccc)  @ @  clgd`cpdd"dc $d$d"d|#d#dcccpgc\cc ccc d@cLccccug(NdPNdSd TdTdcxXdcLcccc{g(c0c8cc@ccHccLccccgg(GdCgCgDeCg-gugkdbdn; &C vkkMPG&"֊/aK+d 5ӆ1 Cͼ-}wp4mG0K=V9'C#=.r *ϝxO K} xV|iqލuݓklRobfF^[^Z}Wf`Sc0M-ZI D@ƥ d'NK`%#/+6lA/ ]D@hf+*{Pu&6>;;kvqUP2M_}1>φ˃4y:Z iYmێ`7Od2z~\sKwV OK86F+GB{\=fX@US]CQ;%)&!,G^(BM6P2,v?kZ;&H VM#RV/K`mpl +e= hﶻ'؀odj#ͳ`~>ɐ}:{y`6q}[Fu2 t-0q].KYT@PENOJ+ GC!}{`COFr[v hJGl0a$-eK^VZp0m5= ^[ Q7R3?>:З$:V -T)y&;h+̠ȥPMlk/|vˡv`#ds'ě yg:Ջb}>  q+2h6mf{u]6@k0-6_[Om>Ic3n+ecc1^'Oo;{mqi_IzOU!jrRd!3M\cX~Twb)bUfXDu&6(GwCji \0BO$`>a[p_#^]bc4aDOrvoQr} ,5NWN`~YfkD|Rdpk)w4X^QX%.Nq}E) f3&bwA@ir~o<8.);W8V^l;lw0IWa:v6Il1l=RWq&'; $z<P5+R?# %85e&`z=jnt7& {drY 2lrefRZl~ThFf t'i]g\aȧ`]g^g.Og\aXo`5Og-gPOg|aNg g\aT`YgYgLg \ag`LgLgtg\aatgLgZg|a̖`Zg[g\g|a<`\gF\g ]g|ah`]g7]gOf|a<`\gF\gf|a<`\gF\g]g\aD`]g]gcg\a`_g_gIgg\a`Nggdggyg\aܮ` `g `g_g\a`_g_g0f|ax`igHg,_g\a`/_gC_gmg \a``jg&gOjg\ah`Ujgkjgg\al`jgjgkg\a`kgvgaf \ah`Ng-gKg|a`KgKgtg \aatgugaTwg|ad!a\wg-gOf |a)a_ugyugawg \a/awgwg=ig\a`CigaigOg|an`OgBgZg \a`Dlg^lgkg\a`kgfHa8gfgcfPcXQgaCf?ffcgTJfg$Jf_KgC`gJfg(\fgJfgX\ffcccyg,aa\a yg@0aata _h<hgahfah,f `$`(`,`0`4`8``````````````D`H`0 `4 `8 `< ` ` `0`4`8`<`@`D`H`L`P`T`X`\```d`h`l`````H`t```````0`4`8`<`@`H`P````H`````````4`8`<`@`D`H`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`#`#`#` #`#`#`#`#` #`$#`(#`%`%` %`%`%`%`%` %`$%`&`&`&`&`&`&`x'`'`'``(`(`)`)`)`*`,`l,`,`h-`l-`p-`3`3`3`3`3`3`3`3`3`3`3`3`3`3`3`4`4`4` 4`4`4`4`4` 4`$4`(4`,4`04`44`84`<4`@4`D4`5`5`6`6`6`6`6`6`6`6`6`6`6`6`6`6`6`6`6`6`7`7`7` 7`9`9` 9`9`9`9`9` 9`$9`(9`,9`09`49`89`<9`@9`D9`H9`L9`9`9`9`9`9`9`<`<`<`<`<`T=`=`?`?`?`?`?`?`@`@`@`@`@A`DA`HA`LA`PA`dA`hA`C`C`C`C`C`C`C`C`C`C`C`C` D`0D`D`D`D`E`xG`|G`G`G`G`G`G`G`G`G`H`H`H`H`PI`TI`I`J`8L`dH>dL>dP>d$GdGdKdKdKdKd KdtLdxLd|LdLdLdLdMdMdNd Nd$NdSdSdSdSdSdSdSdSdSdSdSdSdSdSdSdSdSdSdTdTdTdTdLXdPXdTXdXXd\XdhXdlXdpXdtXdXdXdXd8Yde>eX?e\?eLeLeNeLOePOeTOeXOe\Oe`OedOehOelOepOetOexOe|OeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOeOexeyezeteeeeeečeȍeDeHeeeeeeeeeeeeeēeȓe̓eГeԓeؓeܓeeeeeeeeeee4e8eQ _qs disabledocp@f1000000 simple-bus pin-controller@10000o marvell,88f6281-pinctrlpmx-ge1Hmpp20mpp21mpp22mpp23mpp24mpp25mpp26mpp27mpp30mpp31mpp32mpp33ge1 pmx-nand*mpp0mpp1mpp2mpp3mpp4mpp5mpp18mpp19nandpmx-spimpp0mpp1mpp2mpp3spipmx-twsi0 mpp8mpp9twsi0pmx-uart0 mpp10mpp11uart0pmx-uart1 mpp13mpp14uart1 pmx-sata0mpp5mpp21mpp23sata0pmx-sata1mpp4mpp20mpp22sata1pmx-sdio$mpp12mpp13mpp14mpp15mpp16mpp17sdiopmx-led-health-rmpp46gpiopmx-led-health-gmpp47gpiopmx-led-wmode-rmpp48gpiopmx-led-wmode-gmpp49gpiocore-clocks@10030marvell,kirkwood-core-clocko0spi@10600marvell,orion-spio(sdefault disabledgpio@10100marvell,orion-gpioo@ -#$%&sgpio@10140marvell,orion-gpioo@@- '()si2c@11000marvell,mv64xxx-i2co sdefault disabledserial@12000 ns16550ao  !sdefaultokserial@12100 ns16550ao! "s default disabledmbus-controller@20000marvell,mbus-controllero system-controller@20000 marvell,orion-system-controllero bridge-interrupt-ctrl@20110marvell,orion-bridge-intc-o clock-gating-control@2011cmarvell,kirkwood-gating-clockosl2-cache@20128marvell,kirkwood-cacheo(main-interrupt-ctrl@20200marvell,orion-intc-otimer@20300marvell,orion-timero & swatchdog-timer@20300marvell,orion-wdto(& sokaycrypto@30000marvell,kirkwood-cryptoo*regss4 Iokayehci@50000marvell,orion-ehciosokayxor@60800marvell,orion-xoro okaysxor00bpxor01bp{xor@60900marvell,orion-xoro  okaysxor00bpxor01bp{ethernet-controller@72000marvell,kirkwood-etho @s@okayethernet0-port@0marvell,kirkwood-eth-porto   rgmii-idmdio-bus@72004marvell,orion-mdioo .sokayethernet-phy@04ethernet-phy-id0141.0cb0ethernet-phy-ieee802.3-c22o ethernet-phy@14ethernet-phy-id0141.0cb0ethernet-phy-ieee802.3-c22oethernet-controller@76000marvell,kirkwood-etho`@s@ defaultokayethernet1-port@0marvell,kirkwood-eth-porto rgmii-idsata-phy@82000marvell,mvebu-sata-phyo 4szsataoksata-phy@84000marvell,mvebu-sata-phyo@4szsataokaudio-controller@a0000marvell,kirkwood-audioo "s  zinternal disabledrtc@10300'marvell,kirkwood-rtcmarvell,orion-rtco 5ssata@80000marvell,orion-sataoPsz01 port0port1okaymvsdio@90000marvell,orion-sdioo sdefault0okayBgpio-leds gpio-ledsdefaulthealth-rguruplug:red:health health-gguruplug:green:health wmode-rguruplug:red:wmode wmode-gguruplug:green:wmode  #address-cells#size-cellscompatibleinterrupt-parentmodelbootargsstdout-pathgpio0gpio1i2c0device_typeregclocksclock-namesrangescontrollerpcie-mem-aperturepcie-io-apertureclealebank-widthchip-delaypinctrl-0pinctrl-namesstatuslabelread-onlyphandlebus-rangeassigned-addresses#interrupt-cellsinterrupt-map-maskinterrupt-mapmarvell,pcie-portmarvell,pcie-lanemarvell,pinsmarvell,function#clock-cellscell-indexinterrupts#gpio-cellsgpio-controllerngpiosinterrupt-controllerclock-frequencyreg-shiftmarvell,#interruptsreg-namesmarvell,crypto-sramsmarvell,crypto-sram-sizedmacap,memcpydmacap,xordmacap,memsetmarvell,tx-checksum-limitlocal-mac-addressphy-handlephy-connection-type#phy-cells#sound-dai-cellsphysphy-namesnr-portsbus-widthcap-sdio-irqcap-sd-highspeedcap-mmc-highspeednon-removableX i