jݗ@$ HP3T H2/PH2DPH2iPHP5؀ @HP6 @H2BPH2gPHP34 H2PH2PH 1PH 1ߧPH 1ۧPH 1קPH 1ӧP H1ܧP H1اP H1ԧP H1ЧP H1̧P H1ȧP H1ħP H1P H1P H1P H1P H1P H1P H1PP2HH2IPH !1PH "1PH #1PH2GPĀ̠H &1{PH '1wPH2EPHP2 H2KPH +1gPH ,1cPH -1_PH .1[PH /1WPH 01SPH 11OPH 21KPH 31GPH 41CPH 51?PH 61;PH 717PH 813PH 91/PH :1+PH ;1'PH <1#PH =1PH >1PH ?1PH @1PH A1PH B1 PH C1PH D1PH E0PH F0PH G0PH H0PH I0PH J0PH K0PH L0PH M0ߧPH N0ۧPH O0קPH P0ӧPH Q0ϧPH R0˧PH S0ǧPH T0çPH U0PH V0PH W0PH X0PH Y0PH Z0PH [0PH \0PH ]0PH ^0PH _0PH `0PH a0PH b0PH c0PH d0PH e0PH f0{PH g0wPH h0sPH i0oPH j0kPH k0gPH l0cPH m0_PH n0[PH o0WPH p0SPH q0OPH r0KPH s0GPH t0CPH u0?PH v0;PH w07PH x03PH y0/PH z0+PH {0'PH |0#PH }0PH ~0PH 0PH/<2ۮ@3HH 0 PH0PH 0PH /PH /PH /P2H/<<3HH /PH /PH /PH /ߧPH /ۧPH /קP/<<2HH /ϧPH /˧PH /ǧPH /çPH /PH /PH /PH /PH /PH /PH /PH /PH /PH /PH /P0H0HHĀ̠H /PH /PH /PH /{P 2xHH /sPH /oPH /kPH /gPH /cPH /_PH /[PH /WPH /SPH /OPH /KPH /GPH /CPH /?PH /;PH /7PH /3PH //PH /+PH /'PH /#PH /PH /PH /PH /PH /PH / PH /PH /PH .PH .PH .PH .PH .PH .PH .PH .PH .ߧPH .ۧPH .קPH .ӧPH .ϧPH .˧PH .ǧPH .çPH .PH .PH .PH .PH .PH .PH .PH .PH .PH .PH .PH .PH .PH .PH .PH .PH .PH .{PH .wPH .sPH .oPH .kPH .gPH .cPH ._PH .[PH .WPH .SPH .OPH .KPH .GPH .CPH .?PH .;PH .7PH .3PH ./PH .+PH .'PH .#PH .PH .PH .PHdrS`@ <4`0-< <c< @ 8@8`X(o!@< 88l   ˆ@@`$:I€``QH"(ƀH( !ȁ) ʀ @̠ҁ2`*`ԂDcԢʠ6!€@(`€D0`(`ĀDcĠ+ < ` - Đı  <  -̐`̱`   <  -̀`̡`<H`@PD4swapper||x㿘<4"h  @˔ , &@ @f ,     ?N - @ ? ?&@㿘 <    (#4 㿘      < 4    < 4     < 4    < 4<H     < 4 )    < 4    < 41<< X, ;   ` < 4?㿘@ @><H        %<< "#4? <H@w#  )      ` $4   ` $4< #< <` , ;     $4<H@` , ;       $4<HP       $4<H`       $4<Hp    8<H $4<H@t#xP)<G!@)<!`%!TX`hpxLP@DHX#;@;H;P;X;`;h;p;x#@#D#H#L#P#T/  @@DHPX`hpx@DHLPT )<!%`%!;p;x;;#T;X;`;h@#L#@#D#HO/<⸀K'<+<a+<a 1 9@ % -  , +<%a+<%a/<K+<Sc@` `--``--`-/<%+<%a/<% @̀+<%a+<%a/<%⸧P)<G!@/   @ @)<G!@ @Q)<G!@/ @ J@/ ˬ)0~@/ v @) P)<G!@ @@DĀ̠)<G!@ @@N @)<G!@ @@(ː@)<G!@ @@)ِ@)<G!@ @@L{+<EaĀ@ +<Ea@+<Eb, @`+<Eb$ @`)<G!@ @@VU)<G!@ @@G)<G!@ @@9)<G!@ @@+)<G!@ @@)<G!@ @@)<G!@ @@)<G!@  @ @H`#D#HH`#D#H۬4 `Ā̠(`+<,  Ā̠)<G!@+<c @--@/  Ԃ@" ҂@ ؂@" ւ@@4Ɛ@  !!   ) ꅀ@@-o5 @ @)<@ z)?w @)?@* @`)<5` -0k@` =)<X! *)<[%  %$%)<["x %%%%  % "x /@%%`%% %%%   ' @' @ @`-!`' @-!)?@ @-<%@5 '8)@@)<[5`)< , 05` )@@)<["l%"l @̀)<G!@ ` * @5m@ $#@-5` `@)<G!@ ` * @4w@!** -<r|/<@     ŀ@@@"*@` @&Ԭ@@@@p@`@@E@` @%@A@` @%@=@` @%@@` @%@~@` @%H P9@@n,H`P"*`9@@n HP9!#<b@/<Ȯ-@%]pa(`)<G!@P ` #p=@ (#@H`#D#H #p #@H`#D#H@%#`#D#H/<ʮ<`;``*`w" )<G!@P @%f@#p=@(#@  #p#@H``#D#H$`#Ha*(`/<P)<G!@ #p=@(#@  #p#@H`#D#H*@@ @  2*@@": : : : : : (: 0: 8: @: H: P: X: `: h: p: x*@*@      ( 0 8 @ H P X ` h p x @1@ڒb<@T``P)<G!@ #P@-@I  *耐Ho 耐 P2* 2!聋`!0<#, ` 4,@ `)<#而 @"耐-`;;;;; ;(;0;8 @̀!`_;;;;; ;(;0;8 @̀H`@.!999 9(90989@9H !0P= !p#@#D#H#T;X;`;h@#L;p;x;; p# @30)`@!d!@)`@9b9b9b 9b(9b09b89b@9bH!@1``!0 @̀;H`` H`8oʃ1``8H9```8Hʁ@1``H <@#@ʀ`ʠ;;;;; ;(;0;8)`ʠ$@#ʁ@`"mHs4 ,4 @ (08 @̀7+<c+cp%`T=`X=``=`h@%`LH+cp;p;x;;#@#D#H )@!!0 @4  (08 @̀ 0ɠ 8;``/0⃀8< ``04``⃀04``0+<#@` (08- $@#@` ,`,  @)-'%`@%`D%`H%`T=`X=``=`h@%`L=`p=`x=`=`Š耐44,;;;;; ;(;0;8Š)<#)#p@ -%`@%`D%`H%`T=`X=``=`h@%`L=`p=`x=`=` ? @!0 0, (!Š`4,(@!(;``$ `8o ƒ0``88```8€@0``;;;;; ;(;0;8Š<@(€0(  (888 8(80888@8H 0!0Š` ;;;;; ;(;0;8(` $@#€@`Š4 0`0`'<)< HD@ @ U@_a" @@;@@ 0   @@px耐 P,4 c@DH@@L`TX`h @̀DH@ @Z (@0`@P(0@``L`pxTX`h@DH (08L`pxTX`h@DH @̀ @3@v`8?oć88`Ā@䁔0ćށ02؁ (08u<@Ȃ#@€`  (08(` $Ā#€@`Y0㿘`<I@o!<I 0!@o 㿘<I@n!%Ҁ@&Ԁ@<I@n"<I@n"@/@)㿘<I@n"0<I@n"@$@㿘 <I"P?  < ,   > @nϐ   <I@nȐ"`㿘<I@n"h`<I@n"@ `H#<I!<'<I@nb 8     " <@n`@ @@n @l 㿘` `<I@n#<I#8`@ @Xt 0 "!<I#X! @Xh 㿘@<S<I#h#Ԁ`@$   !! @XN 㿘@<I# !! @X> 㿘 @ <I L@n6#<I#n !! @X' 㿘@<I#^H 7< &8} &80<<"b 1㿘<# H@ ` <<<< `R*@?&$8$$H$$p  @ 0@`@-| 8Y0&$$!@$! <J@m ( <− & &  "<J ` @W <* $䀢&"∁㿘@<JА  !! @W 㿘@<J@k 㿘 @Wz 㿘 @Ws 㿘 @Wl 㿘 @We 㿘<"<J@Ӑ!@㿘<S#Ԩ` @F<! /<┣* 8<Ja@<J@!#<J-<J @ a`  + @ܒ   <J"%<J#<J  b  @ʒ  @ÒÐ━㿘<S#Ԁ` @R0Y< "+   <J"  `<J"@02 2<J"` @<J"@lؒ0. <J "@lϒ0%H/`+ "+ b"   @x b`@{0 㿘 `<"* #<J<J@l"H<J#@l%<J 5<J<J@l#@ P @  $@lc`@j~h㿘@z<D. x<<X "``  "  #`  2    `@z$`㿘@zӐ<!D x. !<X `#@w$  @z$ 㿘 ``<f?,`"    @@<J@j"#<J<J@j#@l#O?H`<␀ <K* <T* ` "␐ (@k  @e  %<X ,`"@*`2`   @(R)@" ""@ze"$$ $ "$ $ $ "@z[ ?㿘<S#Ԁ`  @h ``<`?*`"    @@` `` 2`  <K@k `@? H`<␀ <K* <T* ` "␐ @kx  @ߒ  2$?$ $ $ $ `$ $`""@yߐ   㿘 <"  <c*@  <K!@kA 0 @* H` <K!` ! *` " 㿘 + <"  <c*@  <K!@k 0 @* H` <K!`! *` " H`<Ka "<<* <Ka  <<* <Ka <Th#d#<Th* #d#<Th* 㿘!<!<Ka@^㿘 <"  <c*@  <K!@j0 @*Ho`<     0  0(`Ho`<     0  0 (`<Xp#d#㿘    <*   <" t<L<!8 l<S #ē-*`   2 <L``  ` X`@廐<a@<L #<L;<L @ ``  + @塒 .-.-   /<S <L )<L'<L     @凒  ``<@đ* @a8` IJ @ja<㿘  <". @<S#ē.  ``<L!"`````2 `2 `<L!0 @<L!X@i0)` <L` !@i}0 Ho```"`$ @*  @w`㿘<. # | Ғ@@ *в@+ "@ <. D*` x <X  " `# <" 2    2I<X?+`@В?+`*  Ҳ`:  0 *;<S:``. +  * cđ+ @- @ @* 0@,`@ ,@ L   2E`Ϙ<X`?"`<*`  (l * X㿘?  ` g?<S#ē.  <". @   @@` `` 2`  <L@h!?? H`<␀ <L* <T* ` "␐"@hx  @ߒ  2$?$ $ $ $ `$ $`$@v   |aԒ@@<Đ  ( Բ@@  |a֒@@<Đ  ( *IJ@@<Xt#d#!* Ђ!* Ң㿘 !<<Lb @ʐ!( !(<#Ē  <Lb@!(!(㿘` ;?!!)<@#^/<S-<+<[%<#<!<Ԁ &H/`@" " $$bld#%#c"  2 $# c$c@D! @O@WOԁ?㿘H*/  i#??H/ <aЀ <S#؀`@ @㿘H*/ #<X A#??H/ `@ 2*<!Ѐ` <S#؀` @  L`@2L` `@, <L@B"<L@ef"؝㿘< ` @ *@㿈 <L     #\ #d#`@gL" <<L #@#d $ ( , 0 4 8#\@g>#`㿈H/`#<Lc  $ ( ,#\ 4 #` 8#d <@g"#h 8 <  " 0 㿘㿈<L "   %<M   #\ #`@f#d <L $#@ ( , 0 4 8#\ <#`@f#d @<L D# H L P T X#\ \#`@f#d 8 `"@?@fǐ@`? 㿘<M  P @f  <M   @f  <M $  (@f , 0<M 4  8@f <<M @! D H@f LB H㿘!<#䀢H 8$#㿘!<#!0!hH 8ޖ$#@?` !D c ? !@!@tސ㿘<#䀢@2H 8且 @㰐?   < < <    (< < < ( 0 8 @< 0< 8 H< @< H??```:::`` `(:: :(`0`8:0:8<D#d&&& &`@< < &$ H@&D &@  H@먔 @E$ (&$ H@? ?&D&@ H :8x" & ` @  D;  @j  2 D 8 @;@ ?& 8 "x x `@ 2$ H?` $ 4$ 0' 4 㿘 V!&`&@ &` `&`   <&` @I&`H<&`TL8&`XP`&`\T &``X&`d\&`h`&`ld&`px (,#@ p&`xx <" &`| H 0 @"&`a(&a&a &a&a$@ &a㿘 !<!@쮐 5.`#䀡8H 8*@$#&8 @ &`   .`.``.`*``@ޒ` *"@  @x*` 㿘`? *`@@ <  ** @ @@N@@ 㿘 ِ `  @Uʐ@@U͐/@bccbbcbbccccccccbccbxaaaaaaaa[,[,[,[,[x[,[x[,[,[x[x[x[x[xZZjjZZ[x[x[x[x[xj㿐?"Ho`''""%%%* %*@ @ # H*o``` # &`&`!@T@&`0&@ @ۖ 㿘㿘`0㿈`  D; @      &0C&@!*@'Ho`''!!%%%* %*@ @ # H*o`` ! &&!@S&0& @o 㿈@h " 0 H);D   ?`}{dh s ` P@w< , @ &ഐ`0<䀡2*@"&D* @ 1!  ? ?8@N `!`!  `@? ఐ'@4 (@!*@'H!!%%%* %*@ @ # H*o`0g@v\ ;D @  ?򀢠Y `W` `M `'h`@ C @!*@'H!!%%%* %*@ @ # H*o`& & `& H` & 0`& `  < * @& @M 㿀@  H);D   ?` @ @@ & @ <@ < * @@&80@<䀡2*@"&D*  1!  ? ?8@V !!  @G @0@@ @D@: @/  & & @Or@!*@'H!!%%%* %*@ @ # H*o`0@Lt 㿈@ P0 VD; @ "@@鱐 I?`''@ `$`, `$`0 @$`( ` $`4 ``8@Ҕ `T`0@͔ $` `H @ @@@ @  $`  $`  ?@t p@ "H m kD; e (``]  @  ' ' K'`H @N@!*?H!!%%%* %*@ @ # H*o`&`&`` &`  (@< @ * &@ 8@ `@>  T`0@9  ?@t X @ `? "]x +` ) !!L@K @QL`M`K!Lx@ 'x'|'x `'x!72* @ 2 @I00-`* ?@ @`%?  @u ?0S` `2<S *` €@rd   x!!L!Ѐ`@Ke @P0H ` ` 2  € 2`2*@  * @#@ %%%%+@ *@  @ # d@s!!`0""`" 0"@  &`0 &@ "@`&`0`?&`&`"@  `H @ @@  t t D; <S#Ԁ` 7##   +@H'h h'l@, @ꀢh`$` `$` @&h ` $`  `x@ 蔒`0@ $ `H   @ @  $  $ $`L0&   "&@ڔ @"0 `@  @!0%c% &`H`&`&`& &$&( &8&`8&`4&`0@r @r ""4h@  "`!X `H @ @@  "@  @"@  D; <S#Ԁ` 7##   0``&`&` &@&`@Q @&P .#<c䀡TH 8@*@$c&@8@0 $ $  ܒ@$ 1&8&8 x'x` '|<S *` €'''x&`|&d &hl@ =  `.<S 4*` €&l &p( &l 6p &t &x &| &l &p  &l 6p &D `H     @ @  &H &L  @윐0`H@엔 @!`&`4&`H&`0`&`&` 2&`L4 &`L`&<$t &@  x@ml<t@qȐ @qƐ "`@ ! "  `H @ @@  "@  "@` D; @ <S#Ԁ` 7#@#@   u0q``@0 P$`Đ`5'<䀡`ȑH 8@*@$&@8@  $ $  aP@ 1$`$`$`   @``H@ @"&`4&`H&`0`&`&` "`&`L &`L`$`$t $`  x@l`@q @q @ ` `H @  @@  wH wH D;  <S#Ԁ` 7##   P`H   @  @@ @   `?&&  @n `H&&  &@&`&`0&0& `  $"  @$@@B0 @ @ `!0 @4 @!0$@`  ``` `  $D $L $D $L $H &`H`&`&`@p[ @pY  2% c H/     @  3`* ` * @" %%%%* *  @ # H*o`. H/ @DےH*/ `2" `0"""  `&`0`?&`&` `?D; :?"5  @ "( "% D;  ?򀠠?   @ ?@!!  㿘`/@?@@<M@,!@@v <M"@ @@uŒ<@` ?@v  <M"@@ @$*!<S)<M'<M%<M#Ԁ @? @+@\w!@#@\t@\r<[a t€&p߰&0㿘0//0@u %<S#<M3<[԰0`@> `@+ @\Faa`t ԁ㿘#<c@u <M"h@ۤ@k?@<M@ۛ"@b@jc/ 0$c@u8㿘Ho`X< <Sc؀`"<M@ <M@q#`@n` "<MH*/ @H/ <M@T#x `㿘<X ` <M@[ΐ#@㿘<X  <M@[#@ 0 <M@[#@㿘 !<NN@!@ `2N@?x< X<Nbh<N"< \ 2<[<N"<[!<`<` <#\T<R`"`#d#H #`;hc@_#p 2@[@? d#t@@i㿘<S#Ԁ` 8/ #@x <@㿐@- $ 4㿀6 ?# 2 " ?0 ? @x@-?D;  ?  ? '@b > "`  ?0y * -?0s @ m2 h?D;  ? @y    X@ O@ {J@ E A 0  ?0: , 0?04``  @ؖ䰒 (D; ?& ? " 0@@J @@a?㿘x` ? @馞< ot    *@    ' "<xo 0?  <S#Ԁ`8/ #@ @ <S#Ԁ`8/ #@?<p@?"@0 . @ې "x@x `@?㿘<!0 `"!0 <O`!0@Z??㿘 @Dh ` !h `D;@  ? 2@?@`4'` `/'`'`'''`  @F# !D;  ? 2?&`2?& `?&&h  6?ꀦ`!h'D;@ @9    `!?  @Eې 2"D; @    ?㿘 !@H=㿘<?c @薞<<! @  &`@`D; @  "  @^?@J@@J  @@J@@Iދ@@O@O#t#p@O@O#t#p@O @O#t#p#x@ p\\\\\\\\\\\\@\\\\\\\\\\\\\\\\\\\\\ \\\\\\\\\\\\TЂЊ`H`<X<Tp "@ "` "` "` ` H`<X* "@*` 2` @"@(R  ???Є ??Є??Ɂ㿘@   $   @ '47 `@ `#2.'- ``#*.@ɐ @* Ő  @@ - @ +N  : @N@N @   *? @㿘<O!`@Ɛ $    , @: ` , @ # 2`@L @L @  +  <O`  0 @* @ * *㿘Z *  U .@`2㿘H`%<< !8`!8   #<A  " a     2  $4<88    2 㿘  &@ *`@&@ &J@  @ 6@㿈!<a#@2! !`&!&!! !<O 82 ' !`  = < T`*`,``,`' : 4 !  ,`,`?,`' ;* 1`'*` e'* `'*` 0' % 8'*'* '* '+ 3<' '* 5`'*`!'*  '+ 5<^ ''* f`'*` <'*  '+ )< ''*'*`'a`b-`a`?* :  3* @€`  =  S`-`*`*`*``' @' @ 0!@'!a 0!!a'  @ @ !"  8@@C @'!@ M `  I&!!a' J `,'耢 `m耢 W<O! ! `-` `,  `, M, <O!1 !!a'Ȓ &J `,!'耢 J :' Z耢  <O<O!x !x` -` +  + ! !<O! !` `-` `* `**!a' `&!&!@d `@a`<4 㿘@d@Kא< `@!<5<\!H@"@< 2` "  @  @n @$!H=$!H<Ka<\@@ @ `2` <@ @ @ Д@@ &"  #@ " " 㿘Ho`@dAH*/ <K<(`D0  Є@   "Є@""<\ @<@ > @<<<# "!"("㿘<!@ g`@,g g < g ` 2* g * @ ,g@:@P <,  @ؕ  2 @ْ <,  (? g  ,g g ,g@|*  @ g ,g g ,g@m* @׳  g ,g g `,g 耐``㿘"H 5? 3"(1;,` D  ,``(  @❔ @  @ "H?@,` (,` h@` $@@ڞ @@@`"H?%"Hӓ,`㿘 "H:$"H'; (,"( `D @ @_ @  @ ""H@g  `@$"H), Ā̠+<c!!), Ā̠+<c!!), Ā̠ ), Ā̠!), Ā̠+<c+?b%%%), Ā̠+<c+?b%%%), Ā̠1), Ā̠㿘` P@`@`@a2bb2dd2hh2@ @<!d l L *`*`*`<!d ̆ L ϊ *`*`*`*`㿘<!d`-#<a` H/`a` $a` ` H/`Ђ" <d2(<`dH`<#`d#  `d"` "` "` <`dH`<!h`d!h  `d"` "` "` 㿘@b9  <#<"`d<"!h!h" <Q"  "  ֘   @b@bpx@HPX`hpx(4 㿘@@aɒ@a @| 4@6^ @=9 Y @a  <Q@S*#@aL @a@@{ܖ 4@6: @= 5 @a  <R@S @a( @a@a @{ 4@6 @<  @al<<"b2 @a`0 㿘@@aX@aU 4@aO <Q#@Rǒ@aG0L@aC@@a;  <R@R @a207@a/@a,  @a& @{]  4@@< 0@a<<$@b2 :`$@@a`@a@a@`@`㿘p%x@} "   !"  !" " ," & ,&  㿘ߐ & ?㿘ϐ ?``  ` ` 02` .2` .?# @2 .. 㿘 @ ?㿘 *?`` ``?*. ?*  * ?  *`    D; ?"  ""0" "`("""0"㿘X   *@& & 0&& ϒ㿐 0 4 < @ 8     ʒ `!  ;   & & 0 <\* bH  ` 2 2 X       `2 2 2  \     6\!@!2\!@!2 \d!d 2\!" \@ !! `2     ]      T #"` $ H` x& 4 8"`8 8 4"4 `"  "` `  x"`|$ x<8$ 48$ 88"`4"8 x$  | $ "  x" | @:   `       x    `<d"X*` €@_?`    %x `@ҞQ%x `@߳    @  & & 0&Ҕ0!c!|2 " ?  ( / ? "(0"Y8! "U!"Q`"M`E`"H`@`"C0@"?bH7`":42`"5H"1@"-<%`"(D `"#0" %@` " `  4@  0* <R@P 8G `  *@& u& 0 .0@!! @@>t@@>w؋@@>d@@>gߋ@@>T@@>W @@>D@㿘` @J!X  ! `<R@  0<R@MZ  @7R  㿘@KN㿐  '@ 6` 6` `@(`` *    H* @.`: 5@` *    H* @ *    H* @@o8<R<R@L <R@Lܐ!8<R@Lؐ!xx<R$@LӐ!x<R @Lΐ!<R!& & & 㿘6` 6` `?   `` `  <R @L <R Б6` 2 ` 6` <R@L!<RF"(F06`@ ` (`` `` `*`    H* @.`: 5@` `` `*`    H* @ *    H* @``@<R0q  *   H?@@ ,`@,`<`#"@ ,` , )@@"@ ,` , )@@ "@ ,` , )@@"`7   *    H?@<󀠠 h "`@4`4`*4`*`*1*1*1** *4`*4`***4`** @I"``& & 㿘  !! @5 㿐@ ˑ6` 2 6` 6` 6` `?       = 6`    H*  D? ;  ? + 6`  *  H D? ;  ?  @ ` *  H D? ;  ?   w` `  <R @KC <R{ Б6` <R@K9"^ 6`6`@ ` (`` `` `*`    H* @.`: 5@` `` `*`    H* @ *    H* @"D  r<R0  *   H?@@`` ,`@,`<`#"@ ,` , )@@"@ ,` , )@@ "@ ,` , )@@"`  *    H?@<` p "`@``4`4`*4`*`*1*1*1** *4`*4`***4`** Ho`  *   H?@ '* * H?@  `` ,`@,`<`#" ,` , )@@" ,` , )@@ " ,` , )@@" 4`4`*4`* *1*1*1** *4`*4`***4`**` ".0 `&  &   !! @3Д 㿘`D;@D  @  ? ?0P @  4` `  `4`4` ` @  `  ,`,`2:       )  ) H?    ?򀢠2?   ,  , H?    ?򀢠2?     p@0 @ j@@ͼ  . @a  . "   . H? ?"  a?>!  @o   .  2   ۈ 0B@h   . "   . H? ?"   #? @<* ! @!  ! 6  ! `!!   ФЬдм\DLTdlt㿘x`  @׭X @!X<R#@H}¶ ? 8lxt    , @ "ax  ' "\x!?  <S#Ԁ`2 8/ #@8  @s ?<S#Ԁ`2  8/ #@4?     *2`   `   "  !<0.@ ?$0. @q@   "x@x `@& 㿘x?` @<S#Ԁ`2 x8/ #@(Txx , N</ 0 p@  C" < x"`<@t$@;x#@??,& 8/xx@sM $`( `2"x<b< <:  `<<: b  2$" 2  x" <   @q;  x `@֤㿘x  <`< "㿘<R#@G{?㿘<S 8 < x.  <S h @Gi 㿘<S < . <S h@GU 㿘/:?D; ?  ? /<+?@'$ 'x@U@U @U@8 @U @U@ .&0 ` !H? !eee*e(@ "`H( H? !eee*e(@ "`H( 㿘 ? ?ꀤ & A? #; " D :$& D   $ D  4   4   D @ @ D  ,  "& & 㿈N?t    *@   & > 8? 42?''''    L@w <q  @U`쀢 D;  : "&@㿘 ? ?ꀤ & 5?;& D   $D   4   4   D @ @ӌD  ,  "& & 㿈N?t    *@   & > 8? 4 2?''''    L@ <q 8 @Þ`쀢  D; : &&@$㿘<# @ԵD; @<`h@  `!<  @ ,J A@ S @ \ @ 㰄 @q㿘  !  @/L! <S@EL!ދ?<o<(     /  ?㿘 㿘X !X@֛?    `" xt    *@   & 0  * `& `7'$?7``   "4?  `(77'``  $؀ 6 @T "   @  6R? 2@I? 'P'x B' ' ' @I''T'| '͒ ' '$'(','@'<P @ @/@* 2 <S<Sa@H@, @㿘\@!??  !! `G?EC2 2 2 <SaP@ <SaX@ <Sa`@ <SaH@ <Sfah@ <S<S@D!p?a@  ?@Θ 㿘 ` `@K# @J㿘 ?@W㿘@- 㿘<S@C!?<Tl` `0* ?<o`(#  d  ! a?㿐 '  ?0'#?0$`<o!*` €          '@0@0@ג㿘    ? ?@0@0 `H\@0@㿐    ? ?@t " 0@@@m㿘X`!X@ݔ㿘@6t    , @  $ @2?݁ 㿘@Gt    , @  $ @2?݁ 㿘@Ct    , @  $ @2?݁ 㿘@7t    , @  $ @2?݁ 㿘@t    , @  $ @2?݁ 㿘@Ɩt    , @  $ @2?݁ 㿐 '@N ?c$@ 㿐 ' @Ȕ??t    , @?$2?݀?? ?c$@ hX` !XD;@  ? 2>?@`5'` 0'``'''''`  @.j ; 'D  ?򀢠2?&`2 ?& ?&㿘` (@Y㿘` (@o@2\@@2֋@@2݋@@2;@@2r@@2z@@2@@2~@@2@@2n>@㿐 p?t+  `i  @D; '?  ? U` D !D@ĔE!D q@ @HBa2@""Pa@""*a @"" v@"D }w@ @ِ a@""a@  a@ a)@a(@a@""a@ a@ a,@  a0@" 0! @ "\"#  @"" a;@@ ђ " @ "A"" @6 Œ0!@P !@ P"!@ "<"8!!@0 @7 !@ "C"8!!@7 @>0!@D "a @ a  a a"a"a a a"a "a"a ݒa" ڒa!"גa"Ԓa ђa Βa" ʒa"ǒa"ĒaU"aT aSa1 a2<S@@p!K?I ; ?  ? 9 @έ?$?&?D; ?  ?  @Ώ??&??" ?0 @??Ӑ㿘@۠  @<[ " """  b, "   " `     <S#@@@   7ob, "" "     0"  0㿘㿘@0<S@?#<S@?ܐ#<S@?ؐ#<T@?Ԑ <T@?А (<`Ȁ`"<T<T@@?ǐ H<T@?Đ h@㿘o8<T<T@? xex@? ex<T$@? ex<T @?!<T!8@@  "6    P0 P 6     6  ?  P @ϐ ''H'㿐2 `%x` ` <X<X 2p <#j @M`<U@jڒ O`@2`!G`"@ " #@  @`X*  (`,?`,&`"@ @&`,X2  "X`@ @`\ "`\ `   @gΖ ^E @0d @  `%' @ Q  <?  @ <?"L@*  <@!܀@ <B <@ & @& D& & 6& ` $!$!@(̐ 0, `   @.9$  @Ǟ<T!@@>!@Q  @ͺ $!$! @(`" 㿘`x  @ ;D    ? 2 0Z @0 " @"ߐ @"@ N$ 2G@0 $H`Ԏ`<[" 0*@Ц0A 2$@ $H`Ԏ`<["  *@Ц0@   x@i@#0㿘`8 0 pex @@i J @0 !C"@ " #@  `X*  ( ,? ,$ "@ $ ,X2  "X @ `\ "`\   @fy  4 @8 @̶ $a$a @' '`` ` @-$`֐ @̜<T!@@=a@Pc  @̏ $a$a@'x ex @̑@h J @1 !C p "@ " #@  `X*  ( ,? ,$ "@ $ ,X3  "X @ `\ "`\   @e  2 @3k05 @*j $a$a @'  0%`` ` @,$`ؐ @Y<T!@@<a@Oؐ  @T $a$a@& 㿘 8 00ex @D@h` K @0 !D"@ " #@  `X*  ( ,? ,$ "@ $ ,X2  "X @ `\ "`\    @eY 4 @ˠ8 @˖ $a$a @&v '`` ` @+$`֐ @|<T!@@ K @0 !D"@ " #@  `X*  ( ,? ,& "@ & ,X2  "X @ `\ "`\    @d7 4 @~.8 @t, $!$! @%T ' `   @*$ ֐ @Z<T!@@;A!@N!  @M $!$!@%6 %x `@O @f K` @1 !D 0 "@ " #@  `X*  ( ,? ,& "@ & ,X3  "X @ `\ "`\ `   `@c 2 @05` @ $!$! @$ǔ 0% ` `  @*@$ ؐ @Ξ<T!@@:!@M  @ $!$!@$ 㿘ex @@f" S @2` !K0 "@ " #@  `X*  ( ,? ,$ "@ $ ,X2  "X @ `\ "`\  `    @c 2 @YY05 @PX $a$a @$0 0%`` ` @)$`ؐ @7G<T!@@:a@L  @*B $a$a@$ @*@@*Ӑ@@*ː@@*Ð=@@*B@@*@@*,@@*.@@*@@@*E@@*M@@*@@*{@@*s@@*k@@*n@@*[@@*S@@*K@@*C@@*F@@*3b@@*+c@@*#t@@*y@@*@@* ΋@@*Ћ@@)@@)@@)@@)4@@)ې5@@)ӐF@@)ːK@@)ΐV@@)@@)@@)@@)@㿘1<( @"㿘!<, @`@G?@G=㿘<T@8!X@& < <T*`@8!h<b<* *     <T+<T-<T/<T1<T7<T3<[5<S   $" `` (  !(뀢  !@8w@8ta@8q@8n@8k!ؠb  @8gԒ`<T @8_"@@㿘<H< ` # #<'< $2 * @*` " "@n $0 $<<*` <<(bЇ( " " " " & ( " ( "  :     ( ( " " 㿘` @"<T@l#@3."@:p<['"@&@'''x'T@Fa'x @F[8j'_? " @ @'Ԁ'خ8'ܺ"@@F? ܒ% @  @9831<@F+@F'T@F$"!$@F @F<"#2` <*b *   `& $@/ $@x$$ Ҡ @ @  ؐ@  '䀥@ @E ?x@E㿘 @}ƒ   <T@7T#8  0<a` "`a` "`<`$ $ $ $ $  $"`<< "@" 㿘<* aD@ <%x"ᄔĘ< @'ɒ #<`D "`D㿘<!D.  " %x `}"`` x<`s<!x  <| <<a  "a<"|"x"!! d#< <T@6#Xa`  "`! 2 @<T@6Ԑ#xa`  P"`@EN@EL 4a@EG /a@EB @E= @E:@E7a @" @E- @E*@E' a@_a a`   "` a "@   <!  `" $!$! @ }  㿘<` > HH/ $`   @ńq @a    ?      @X_@~  㿘 <Tc!l!d@’?"@"`%% %* %<T*  @ # !!@6#%<HHo` #<H/ @H*/ @'`  rH@&ǐ@@&@@ "@ 088(@ @  "+"0*6? @ @` @` "0"` @   @ "0"` 㿘<  "  4   8 "   2 4 <2 ? ?(<2`0(?"@<2 ? ?(<2`0(?"@<2 ? ?(<2`0(?"@<2 ? ?(@<*<2 ? ?(@<*<2 ? ?(@<*< ??* << ??* << ??* <2 <Xᴅ( 2  <:  2  <"2  2  2 *  㿘6`<Xa* @@ 6`@C]`㿘6`<Xa* @@ 6`@CP`㿘6`<Xa* @@ 6`@CC`㿘<@ :&@ &@2`@C6`㿘<@ :&@ &@2`@C)`㿘<@ :&@ &@2`@C`㿘<&@2`@C`㿘<&@2`@C `㿘<&@2`@C`㿘%x`$?` @B %x<Y$ἑ* @B@B%x㿘6` < |`?<["   6    <<*` ! * !(!<<*` !* &   "  & *` *  *  *  : * @ " @B.`J @x "@h`"<$@2 * <@*` @B?#$  $ " "<@ `@Bn.`@"  ?#" `" ` <U@BZ .` @3Ӑ ` @BP<"0 <(b(` <[ "` 2`  ("`   㿘6`< |`?<["   6    <<*` ! * !(!<<*` !* &   "  & *` *  *  *  : * @ " @A.`J @Œ "@`"<$@2 * <@*` @Aϐ?#$  $ " "<@ `@A.`@"  ?#" `" ` <U@A .` @3  S @A<"0 <(b(` <[ "`" 2 `  ("`   㿘<[" (   `<2*@* @$*@ &  %b <"b & *` *  *  *   : * @ " I @1 D<#@AH  ,@  $,@@a,@@@X,@@@O,, @@D@<& 2` *`< * @A $ b b $  %b  " 㿘<8  4 "<[%x " 4@@" 42%x<[" ,6 . #<<"$ *` *  *  *  :  * @"@ "$ "( "," @@Ȑ   <z㿘~@ Ȑ0z 0  @ `    /  /<z  㿘<U@2 0<U $`@2 <UA Н㿘%x`$2D%x<["<"< <Ya" "$`$ ""` # $$$ <Y!Ĥ!x "<U@/ؐ @@Z @@X  "` "$$ "$ " $ $ $`$%x<Ya$ * @@@%x" $Ң㿘<["<"<<Y a" "$`$ ""` & $%$ <Y!Ģ!x "<U@/ @@ @@  ?" "@$`$ "$` " $ $ & $@?<Y $*  @?@?x" $Ң㿘<9!x0` 6`* @?@?6  .  @?Ր@?Ғ@?㿘<9!x6 ` * @?Ő@?Ò<,`@? @?@?㿘 @ 㿘@Z 㿘< @"%x@ %x`$?` @  %x<Y$ἑ* @?@ %x㿘<["<"<<Y a" "$`$ ""` & $%$ <Y!Ģ!x "<U@. @?d @?b  ?" "@$`$ "$` " $ $ & $ <X2`* <Y $@ !*2` `z@ M 0x" $Ң㿐ۅ?<# ЂA̐ ` `2` @ '` @ 㿘 $?+lH/`"ނ $Ң?  @ `    #`cbmlkji ?"ޢ 㿘 $?5<H/`"‚ $Ң?@  @ `   @ ?#1@B B/B#B"B-B,B+B*@2@@*@"¢ 㿘 $?+H/`"ނ $Ңp  @ `    o     ?"ޢ  0  @ `    / 㿘$`<᠄  $ "#ʂƢ`ʢ<   $?? @ b"@ʂ@֢@bʢ@< $ p"ʀƠ`ʠ< 㿘0~@㿘6`<X!*` @ 6``z@ 㿘< @p@ %x`$?` @= %x<Y$ἑ* @=@=%x㿘< @"%x@=%x`$?` @=ސ %x<Y$ἑ* @=֐@=%x㿘< @p  @ `    o    ?%x`$?` @= %x<Y$ἑ* @=@=%x㿘%x`$K<["<"< <Ya" "$`$ ""` # $#$ <Y!Ĥ!x "<U@, @=w @=u  "` "$$ "$ " $ $ $`$%x<X` 2`* <Y`$@ !*2` `z@ %x" $Ң㿘<["<"<<Y a" "$`$ ""` & $$$ <Y!Ģ!x "<U@, @=& @=$  ?" "@$`$ "$` " $ $ & $ <X2`* <Y $@ !*2` `z@x  $"Ң㿐<!!<[#\<[ <U"#`@c㿘 $?&  "@<ؐ<Ya $<* @<В`@<ΐ $<["*@  <[@ b< @  "#@ `# ""`?& $㿘  w H` 0 fp `  x B" ;<X !@@ "5   /`4 *` "# ~ 4 `" 4 @" @  2  @`@, )   2  `$`$ ""   $ @{K ` `   ` : @02 2 <Xᴅ( <2 0("?<  @< <"<  `?㿘@:   @  `?㿘@:В <*`?  @  `?㿘@:   @ 2` *` 㿘6``㿘6` `㿘6``㿘6` `㿘6``㿘6` `<[  5    <<( (!(<<(("  b "b "(((( `8(  "`<[ '   <2((("  "b <b "(((( ` 8(  "` <"0 <(b(` <[ "` 2`  ("`   㿘@9 㿘0@@9&p@ `*`" ?㿘@9ې `.`& ?㿘`  .` @"p`  @9$0@ " `0㿘<!<`   <[#`     &2 * o pH<8 c @zf @V`2<V@j"p@1 "<@ x Ā`@fx@9ex@9b@9`@9^@9Z@9W`@9R2   @9L2   $&0 @9B฀  0@e$0 0< Ā`  0@#$0 @9 " 㿘o/2 ``"o"1!2o((p * ( 4 *   ?.   "@  ?2  ` 22 ?*   @   2  `@* Ą< <V#x@(3  : *` 2  *  ! ! @8$?, 2  ? `  4 (` +@<(, "@ 㿘H/`Z 㿘H/`` .`A & ? 㿘H/`/0 0 @6  (` .@  6  㿘Ho` + / 0 6  6 (` +@Ş  6 `+`㿘op9<8  @xɒ @`2x<V@͐#@@7ג@7Ւ@7Ӓ @7ϐ@7̐<a&0 2 * @72  ?  ("@ 2  ͐ @7@7㿘o:  "H` ?* @.   2*   .  "@ `?2 `? ?2@ 2@?*     2  `?* @Ć<   <V#@&ƒ  : *` 2  ? * @ $ $ "* ? @ 2(` *@՞?㿘!4 @7p2 h ?,  o"@ 耐   <["8<[b@B`  $ 耐  <[b<[8@ @@@@@@  $E 耐  <[b<[8*o * " * €Œ‚ƒ„… $"ցС$΁`""  #@"֡  $+ 耐  <[b"*oԂĢdƒ@` "p "@BB B BBBoBB#"ԡ@`<[b*/ $ʁ` `"0"  /#@$@`" $ʀ@#Ҡ@`ʠ@" $ʀ@ ?֠@ @ b@`"@ @ *@`ʠ@ " $*oʀ@֠@@`ʠ@<"<" "<X2 *` 0(0  @*` *@ęA  *``<X2 *` 0  p  ĺ@ĺ@   $0  耐  $@`" $ʀ@#Ҡ@`ʠ@" $ʀ@ ?֠@ @ b@`"@ @ *@`ʠ@ " $ʀ@ p֠@@`ʠ@  $  耐  @` $$@` " $*o ʀ@֠@@`ʠ@ `: `: `: `: `8: 8`0: 0`(: (` : `X: X`P: P`H: H`@: @`x: x`p: p`h: h``: ``: `: `: `: `: `: `: `: `: `: `: `: `: `: `: `: `!a<B!<`<@`" @ @ A@` $$@` " $*o$@`<"<㿘<["P `" <W@$D   @@@@@ Ċ@`<[⠀@@㿘<[`1@@@@@@@@ ́㿘ċ`<[⠀<[`1@@@@@@@@  㿘0ă$1 <[P"01@@@@@@@  㿘0ă$1 <[`1@@@@@@@   Ċ@#ddƪ@<K#d#㿘<["L!" <C" <["L <["L!D<C"a<C<C!H"<C!L<C"a<C<C!P"<W@"(@<["` `<W<C!T<C"b@"P@<["P ` <C<C!`"bh<C<C!d"p ` ` <W<C!\<C"bh@Ȑ"x@㿘op#=##<%<W @t @ @`@t;$<2  Ц&0  "`"@  "" `<""` *"`"@ " " "`"`      㿘@. `"<# #8*""< Ò㿘@<X`!# "`&` ؊@<[  <[  ƪ@Ҫ` ب@ ֊@<[ 6   Ī@Ъ@` ֨@㿘H/`@$!  @[`Ь@@p@`%<[@`Ъ@`{@2@ @ 㿘H/`@!!  @%`Ь@`%<[@`Ъ@`H@2@ @ 㿘<X! `a<[<[bX"x  0 F5"xa㿘<  `A!< ̀  < ̰>$ !$!  @ `Ь@<[bX  <[ <[" Ԫ@` `* " <#`#8*#" @0 ""@? "<X a""`?"`㿘!<<  ̀@ <`` `<X@!`# "`#` ̐ $ ́㿘<W#@#<W@!#㿘Ho`?v<Р"T$ ʐ`㿘Ho`? Ў` * <c8*7 <["X`#0C< 1<`А "`Ё`㿘 @r  <Z !0<Y!ԓ*  *`2!0@rY ? #!0?*  <Y!ԓ*" Ԏ`<[" <[<["X` 0Ђ@ $0@$0 0҂`0.,$0<$2 8< Ц<p$ 2` 8<@&0Ң㿘<Ԇ?# @*  0 2` Ѓ &0&0 0҂` Ц ң<Y<!0,  &"0 @q     *@`  &** ?/@㿘<҆?# @@*`  2  ƐĐ&0 Ц&0Ц<Y<!0,  &"0@q     *@`  &** ?@㿘//2  H/`7<<@5<!D+<?4*    /50  " 4@/0  / 0 2 , @     2  `_ <*  2@ `4<!@  <*  2@ `"4@4*  c ?a< @  ,` 1U!<!<$!<#=#'<+8<&4` @4(`@  @ (@4, ΐ @ &0 4 <W@!#<X@ 㿘//2 0Ho`<`<<!@ a4 ئ&00 (`*@˞`&0<a4" 2 <!@:*` 2 a4 :* `"a4 *  #? <   a<@ &a<a< a<`㿘<0<b"2 Ԑ? 㿘` .` & ?㿘<!4 y㿘` .` o ?㿘<["`<@` <   @ `    !! !@!`!!!!" 0    0 @ P ` p        ! 㿘 $?>˨<. "c8* @ 2 H/` @!  @@@@@0%<[Ъ@` 2 @ 㿘 $d,$#<, c8aH`   *? ; @@  "  @ @ : pЂ 6"p"p@ p <[" Ԫ@`K@ `*  @㿘 $?!! @Ho`@pІ@  @ @`H` 0Ă㿘 $:<,`"c8* @ . Ho` @  @@)<[ "Ъ@`̐2 @`㿘 $`,$#<, c8}H/`   *; 7 @@ $@  @  :$0 V <[" Ԫ@`k  *  @ 㿘 $?! @Ho`@g @`㿘H/`O 㿘Ho`<["x"x @@` +<["P   <[ <[" @ <["  ҫ@֪``@  ۠ @`㿘 $?7. "<* c8 H/` @!  @@@@@0%<[Ъ@` 2 @ 㿘 $H,`"<* c8 H/`    *$   @@'<['  Ъ@``@`* @ $% Ј@H`ƨ@ p pĀ  Ģ@ Ш@㿘 $3,`"<* c8 Ho` @  @@)<[ "Ъ@`2 @`㿘 $H,`"<* c8 H/`    *$   @@'<[  Ъ@`@`* @ 㿘 $! @Ho`Ҫ@p Ц@ @@`"<[?= 2    * Ģ@ Ģ㿘<["<"<@<Y`@a"@`"#@`#`""``& $$#` <Y!Ą!x` "@@?`<"`8@"@#@#`" ` " $`#` & $`*`" *  ` } 㿘%x $2<[%x"*@  <Y@ a @  "#@ `# ""`%x  $Ҫ@㿘x  $Ҫ@㿘 $!  *`" <8*  ':  $<["*`  <[<  ?#@# """& $㿘<["<"<@<Y`@a"@`"#@`#`""``& $$#` <Y!Ą!x` "@@?`<"`8@"@#@#`" ` " $`#` & $`*`" *  ` ! 㿘%x $2<[%x"*@  <Y@ a @  "#@ `# ""`%x  $Ҫ@㿘x  $Ҫ@㿘 $!  *`" <8*  'ސ  $<["*`  <[<  ?#@# """& $x<["   <[<#8 bP <XbP``<X!<X! bP<[`<["x`#\<X!#h <#`< #d< #l#p#t@ @ "`? /g  <"<ⴅ0    "     <"2  2  <"2  ? * < 2` *` 2` 0 o 㿘<X@!(㿘?#@6`  c <X@u!X 2.`0 <X@j! g& 㿘@j 㿘@j 㿘<[ `   " "`@)Ű @)` "`@) @)`" <[ "  㿘6` @=c ,<["   " &?"`.``g$@)@ @jm @]@  .` g$@@j% @ 2@@.`0 <X@!  g$@<[ `  "` "`"`<[  "` "`㿘<[b  b "b  &?" @j @/< @)0# * " @O*㿘 0  `2` Fp x  1"@)@<@"%   " @ @( $@($p@* 2# ÒȒ$㿘H`pԎ@`<[" H*+?@ $  '<, $c8*" *    Ԫ`@ @"=#)     Ф@$p@$p@   #Y0 <#8, <a`$ $ " "`  A.Ц@ 0㿘!<!P <X@̐"(!P㿘<X"P  <!T `?㿘<X"h<   @<Ho`&"؁` <!H@ E #x'@k'<X"x<4a"x  4a 4a <4a"P"aTH/ 8 ?$e$e ee* *@ @ $`H*o`'''' ؔ @)<'</<!H $@Ho`H "'%!H`؀ 2$@@H` `2"`؀ LH/`$؁   L  €"` 2 L@  #`   ?  <      !4?`@beeee* *  @ $`㿐<aL''H`aL "'"aL'<  !X@.?H` `2"`㿘<! & ``㿘%%&%& &%&%`&%#<1<\@@^Cah 4 @ 2@% @2   ?㿘   @  !8  2  ` L -  "'6` 2 " 6` $@! @ɔ <ah@]<\`4 @:@  2 6`&@&`&`&`  ?2`* ` * *# 堔+ 嘐*@ @  "  <X@"! #2`( `0  唀 * (   0      㿘 @ݢ?ꀦ` ?`". ` 4* ?"' 2ll@"  @ "  @ " \  !! ` H`  ?0` *<!*` € 2@ * &L&* *@   *@# * *@ @ &[ W <\?2*  2@ `K?;2 4< 4܀@ <ah@\U $ @)"`"&` """ `"2 " 2"" "@  ?` ???2*   +@  # @ 2 "&  @)㿘Ho``?`&?* * `@ ""@ 2*`  * *# * *@ @ &`㿘? <8  4 ? d2  4є "` 42 d`2 㿘"? <8  4 ? p " 4 l2  4 "` 42 p`2 㿘d?! <8 4  `   ? 42`  ?>  <\* bH  ?`2?W㿘@ N㿘( 㿘Z@ 㿘u@ 㿘@ >  <\* bH  ?`2?  ` 'x ' '''|"  <X L      @" xx' x !@T 㿈?ꀦ`hD;@  ?@     ~@!*@'Ho` ' '  ?2?     @& &    + *&& !!堔+ 嘐*@ @ "H*o` .2D* ( Ho`''H*/ #;D?@    " 㿐`1?H/  @  @ @ H*o`D;  ?@n    " 9 D; @W  ?@!*@'  8 &  8& D @:    ?沐!@耢 ?H/ h : f'`'d  @   %%%* %*@ @ # H*o`cQ" c&%b@b. @*`@*`@耢  쀢     !@H/ `!d!堔+ 嘐*@ @ "H*/  `D@@   ? ?? @Ix'x'|'`'7xD; x@v   ? 4??2'x?>  <\* bH  ?`2?x㿘? ?`  ?H/ . * ?쀦@ @ &&& & &&`W@@#@ `"`"` " `*@ "`" "@  B?퀢  = &?6* 2@ `6`#<!<\`"@  &@!@Y0ah 4 @z@`2`6*`  * *# 堔+ 嘐*@ @ "H*/  㿈` ''    @@ @  '쀦 6`D; ?  ? = 8  3  .?  @@ !?ꀊ  ?!!` D;@ ?@e   " 㿐`WD;@  ?@N    Z?" @'H '  ??  "* "!堔+ 嘐*@ @ "H*o` 2 D  #;'D?@    " 㿐Ho` 'H*o`D;  ? @̔    " H?  eee*e(@ "`H( h $''GȀ ȁ㿘> <\* bH  ?`2?8%%%* %(@ @ " |<H㿘㿘    `" %xx"` @"耦 &@ &@ &㿘H/` <& <8  <<& @" <& <"@`"⸁ 0 㿘ِ㿘H/`  H<X<al<", "@ 1 < `*`)",#<2` ` !(#<2` ` $#<2` `# 2`<"("(*` <*`"@@ &@" "@&  0#@,0㿘H`& <l<,` 1 <(),<0 (<0 $<0 0<(((<(&  &㿘Ho`    && `㿀# @( %<<X#@@<!Ġ'''''@Ð@$ `&  㿘㿐H*/ <`#<X '<X` (<<`HD<G, #@H <8   < $ $<?@""@"`<$<$@$ <`<  " #耢 xx@" $<  < 2 S H*/ <DȒ`"<#䀢@* "@ 2 x 2x@fx<`d< "`dĘ#H9P 9# `8 0oH*/ 4 :  "4 2H/ f  ?$ "#耢` `@ V@(*$<GH/``"`  `  €"` 2 ` @$<" @"<$<`@"`@$@"<<X@X# 㿘 "?  ` `@  `D `"  쀦㿘  @; Ӓ #㿐'' $H`    '&   $Ho  & & ` $H` `2"`㿐'' $H`  '$3 $Ho @ & $@ `     @? ߀ " $H` `2"`㿘Ho&  ``?  @m㿐 !'Ho` ?'&H/  `2"``㿐 !'Ho` ?'&dH/  `2"``㿐 !'Ho` ?'b&H/  `2"``㿐 !'Ho` ?'&H/  `2"``㿘㿘<`쀢 H/``"`쁊     €"` 2 㿘<` H/``"`     €"` 2 㿘<84 " ("(24(4㿘<R!<> %< "" @$< `?< p*` €   2$`0 .$`!<\T"@@a '<"@ <Y$"@$`@  <!<\"@T @oa <"@ `<Y$"@$`@  H < $` 0"$`<!  <a :4 < * #!"a  <a :4" <*#!"a  <`(  x "`(< 0# <# "$$<< @a a : "@#a : #a a 6: : :  ": #a 㿘<(<  ,<耦4&a, 6(&a,(a, &(<\<@<a,9< 3?!& '! 8(&'!&0 >. &'!&㿘!<\? "@А"?@ ?/a ""@`$"@㿘/  @ "@"  Ԓ@@& & Ԓ d@N!p @ d  d   d@>!t         &&     @  && 㿘 ` &  " #  # #    <<!D@ "aD  "aDD` "`   㿐Ho`<"L""LK<bP @1<bH" /"bH!W"bH%<<<`(`#@, +`* "@+#@ *`* +`*(@* #@ *`+  @#*@ *2 $<2 2` $`$`.H*/  <H*/ <8 <\ !8 3<+<8 "a@@@ *`@"8H*/ `88H/ a@b,@ %<1<(' -<_<Xc<"` * @`@<#a(<#`$<#c ", b, "l @  2 2 2   2(* *  #" "`# *`"   ? @ (`` (( *` *%l!<  `  "@" ## H*/  Ho`"(* @ 2 (%lb, ` %b,E$(#<a(#<`$#<<c "",' lb,!"  2 2  2   2(*  *  #" "#  a@b,@(H*/ 㿘3<a@5<7<D&a@L &L`@&D<P P<쀠 &Dx'''' @q䀢` 㿘`㿘t`㿘㿘㿘㿘㿘  \  !  ? (8 (  $ (8 (! 㿐?ꀦ D; ?@L    sH/  >  <\* bH ` ``2` L?``E? cA?ꀠ`?`?@: ?\ @ !! `*@ \@ !! `" < "@<8"@" <`"@`<"`<"<" @ !H*/ 㿘s㿘l?㿘 ??> <\(H`22㿐`,?ꀦ &*>  <\* bH ` ``2` "? 'D;@ @@     ?㿘H2 ! !@<8<& @&`< <@ @ @&`@94 , < . @ϐ@@ː@  `,` ``* @ <Y`"`@l`  $@< 2%* ` @``"`  "`  @&et  @p@mb8@K㿈?'''` H?@! @Ҕ%x `@GAl` ?@@* @&<"a   <Ā`" @"Ĕ " l$"<!D"`: `` ` @ `"H`"`` ` @H `"?\ * @ + $\$$ `@ @$Y$<$a@?$x$$0$$t$`$<$@$|$$$$$$$$$$$$$$$p$h$$$$ؐ|$$|?ǒ 2u" p@%  @J  $p? "@pp`" p``"p@ "@p" p` `"p@ "@p " C( @k  @J&$` ? "@& @` %! x`@N$$$$$$x@  $? $x$$$$$$@( 2% x@x`d7#<]b?@ID  "bx@$`$ `$ ` $ `$ `$ `$ `$ ` $ `$$ $`($ (`,$ ,`0 $ 0`4 @$ 44 $  % $  0"x  "  h"`  "` $ `  "`$$` ` $ $x@' 2@ ( " @`"@@@$ %@  ` `<]   @1x@+    @ $x u8 j   $$$P$$T: !`=$H/ <8$48$88"`4"8x$ | $" x" |`:` <\* bH  $ "`" $ &H*o`$<$@<b "bx `@Ie   @N`<Fx$x@@Ԑ@`"H`` ` @4 `"H`"`` ` @#H `"<b""bl @ox@@5@@@㿘 `    `@֞ ` " @*!X ! `  `@ ` "  `` < @ @0 } 㿘<#l @* @  2 <Y@j"а  2?ꀠ<?l" cl ?cl "cl<l l ` "``?㿘?/X *?X `` ` @E ` "! !X`    `@ ` "㿘!<!'H'L'P'T'XH@|<Y@#<aD<X<Y@#0 <X <Y@#@0@g@3<<#t 5<1   cp  2cp`$ <Y@Đ#hcp*`" *  * d#??  <.""<Y@#H*o`( (@L(pp0,dޔ㿐 `s <!l*` €`k?ꀦhf D;@ :? ]<#x`A <c|'H`c| "'"c| !x  2>̞!H` `2"`  Ho`x -+<!c< cx   #cxH*/ .@` Ho`cx  H*/ Ӱ  `ϰ?ꀦʰ D;@ :? H/  8 <c82"c<#<ccx 3@ .#<a    H*o`(Ho` ccx@ ޔ H*/  f c&@.@  `0YH/ <"cH*/ 0DHo`< #Ho`<#<"cH*/ 0! ?<#&H/ <"cH*/  ?㿘 \@ !! `?r㿘'H'L'P'T'XH`!<!@zHf#<Lc L <2 ?L  / 74?L  >"  ? <,< c > 0, ,  ?,c !3<<!c<<<cx +#cx # ##L` "   cxcLc  <# $` " `(``(`2` ` ,c Lc<#|) !㿘@-H`<#  "  (  ( 2 㿘Ho`<#  "  (  " ( ( 2 `㿈<#` V " &6 " € <\  6 %c<\  @ "8    @wy 2$V "` @2`6  6 "  € 2   6 c 6 " 6  `L Ґ sHo` <`2`(& ("& ("`( T<c<x#  I <<!c  ,@ ?L@`  x? .,@ O耢 <2 O逢 / 逢 74 Oꀢ >2 К? <#- :`@ ?   ?L@` "  x* ` H`<2( (  "(2( ( 㿘  l  @ l < @$@@ ""@<㬀 @`  `?? `!`"``  2 `2  ` "d d"! `? 㿘P?ꠖ   8   (" <8 4 ": #  "-4@ @ \ !! `  " (&\ !! `2& 4͐ 㿘`??<8   4  u " 4 4 4㾘\@ !! `?w?"2? !i@ D!@!@?3{!#;< H"j!-(l#Ԁa?0!g" <4#?0"܀9?0z# 3   2<Z  2<Z q d < _"c<\"## <Z3   2<Z  2<Z +@֐ <# <Z3   2<Z  2<Zߐ w@ D; ?@> <?#/ 5  2<Z  2<Z   㿘<#`<# #     2 0  歔 * ?2 "1\@ ! >?1*`?0"1"1"1\@ ! "111?+ ?022 1 1\ (!\ \@ ! * 111 10@"1@2 ?11  \(!\ 㿘. ?#6  *\  !! `p?*2 .` ?2`#@ "1  "1  "1 \  !! `P?1 1*?2`#22@@1 @1 \ *@!\@<1< `*     h !d!\ 2!\  d!\㿘\   !! `. 2 1 1  12  "1  2@?1 1 \*@!\<1< `* `    h !d!\ 2!\  d!\㿘\   !! `<. ?#2@".`@" .`@".` @2w?.`?2`#@".@" .@". @2d?.?2`#@?@ ?@ ? @?O??#2@.`1.`2 @" .@ \*@!\1 1.?2`#@21 < `* `` `  ` `h `!d!\` 2!\`  d!\D; D2?  @ ?2@  ? 2\@ ! <* ?3 "*`" *`"*`2F?*`?0"*" *"*23?*?0? ? ????3  21*`0 " * \(!\11*?021 D; D2?  @ ?2@  ?2* 2  "1   "1 \ ! " 1   \(!\<`  `\!\  d\!\ * 2 "1 "1\@ ! "1  \(!\ 㿘 <D; @    ?<!@ "``"`: E?<\(H?"; `2"4 x"lt ll&?\?2! p?@<84d 24ll" "d4 2d "d   : d<\(H" ?`2?dd : l<\(H" ?`2?l<8`4@ ?`d``4@ 2`d` !d!p!l!!h㿘 &??ꔄ  D;@ @>  ?㿘\ @ !! ` ?? D;@  @ 2?! * 2 " @`  * 2 " @`  㿘< # @rD; @<`h@ϔ! ! 2?c @G㿘\@ !! ``@-?+?<c @;<  ` ?D;    @ `#< h A*  @ 㿘`,?<c @ <  @ 4  D; @ @^ 2? @מ㿘\@ !! ``@-?+?<c @˞~< !` ?D;    @$ `#< h!E*  @f㿘 (D?;@  . ap @     ?㿐 8B?D;@ @    1? 􀢠. (?!p@4\ \@@ !! `  @  ? $"?" "P@~j H&`2K  @zE d' @y d* @*`"@*`@ ԓ*`'@z6 d' @y| d* @*`"@*` @ *`'%  ؒ d@z"' d@yh* @*`"@*` ܒ@*`' d@z' d@yX* @*`"@*`!@ *`' ''1'ؒ d Р@y' d@y@* @*`"@*`@ ܓ*` ' d@y' d@y.* @*`"@*`@ *`! '  '   ''D; @( H  H  ?㿘` g?㿘p!`@    `@? `?4?!Th&  0  h(*`!h? 1@@!.@F@O@h@~@@ 㿐@\  !! `P?< D !? @E\ 2D?; ?@V /4?$ "?@E  ``H$@ ?@ ?@6 "?@} H!<  H H& & && @{e`@D $ @D H@\ ? !! `< D !? @D 2D?; ?@ /4?$@ "?@D b@ 2DX?;@  @ ?`2J?Ā L<Z\!A?@z HD@ @@ܔ H  H *?` ?@ <Z>!` ``H @ @ (`<Z.! "`` @*<Z* @ <Z!``"`,`$ <Z*` * @ <Z "`,` @ <Z@ @<Z"@ސ`0` @ <Z@ @<Z"pА`4`8@ `@ <Z@ <Z"@ "`<Zؐ"?<Zѐ"@ G(#`D  <Z@ <Z"# D  ? @D ?D ?@`/4?% "?@Cǒ  t<Z@l <Z#(d` ? `HD @ @  P? `$``$ $$`(<c<Z@<Z<  c" "   T3( ""(`"`  @Ct @Cq ` `, @$` $`€ ?`$` ?$`` @N`   ?$`"#`@CO @yĔ H@CH 㿐@\ ? !! ``"P<<@ D  ? @C^ 2D?; @ ?@X /4?$ "?@C j?@ ? @C 0]@B  ( X? G(   D "  I@ E <`# ,  ( #   ` 2 G(   D "   2  2  `(  $ @Ғ  2 (`2<    ?$   2  㿘<<  c@    );@{` (  D`@  c`@&@D; ?&  ? ?`c@';" D`@z`@D?&`??㿘<#2 g?ꀊ A " D;  &2 0? $ +;  $`@z (  D@@{   @&  D; ?& %?# !? #;,*  $`@zv`   D?&`??㿘<#2 ^?ꀊ A " (D;  &/ -? ! );  @zC '  D@@   @& D; ?& ? ?  #;" D @z`  D?&`??㿘  A " D;  & ?D  *` +;8B D@& &-@@y` 3  D `@  2;?@&@`25?&` " .? &` ײ`D?&`?  : D`@y   `D?&`??㿈<# 4?ꀦ("? ' '`G' D ? 'D;@  @A    "D?1;D & ? ?㿐 <:#< D  ? @@ ?D; ?@| /4? $@ "?@@  > ?@ @@ 03<#@@ `+<#.` €% ޔ* ^?X<       P@xe @` J -;  AA 2@  #/' @i; ;/D);@~ @  @ *  ! @  @'`@i      @k6 @  @4 $ ``2`$&&@㿘< `'" ``@gΒ 2`` A 2`` "`  `  @g ?   ``ހ 㿘P<[e <b""bđH/ <b ?"b "  " 4 8"`8 8 4"4 `"  "` `"  x"`|H*/    @ !   @ ! ! @ @p!0"` <84?l d 2` " 4 l` d 2` <84""  "4d24"4x`" 4d" 4ll24 倢  㿘Ւ 㿘%t B&%t @}:  @!)<\,@  " 6  ,` "6 " @MW6   ` ,@ @& "  @  d"8@{  @x "8@4#㿘%p &%p @}f@ @ @5V㿘%H/`  &% @}H@5<բ 㿘%x<#@@@! * <`&%x@&! 㿘<8  4   %< t2 4%$ P`  T$%$ t ڔ  42 txd d (  ll@2$P    d`  `4@  `d 2`4@ 2`4    ׽ d ׹ P "P%  "P\  !! `2P !PPĐHo`S| !| $  t $ $ x | $ "  x" |`2 d Pף dd@"8| ll@23|H*/ Ð `  `4@  `d2`4@ 2`4    M I H/ | 2|H*o`p @: 㿘<X !<X @`<[ ` 2<[    $`$ : /<?$ @x"t@|@z@x *@$<`@o$x t`C$t @|2<p``a-<\- @   " 4 `, "4 " @K4 ` `- `&`"``@k `d8@``@`8@2yp $p @{2 @ @ @3唡H/`  $唄 @{@3  $v$L`"H`` ` @{ `"H``` ` @{vH `"ɞ$㿘 )* 㿐#''?H`@ "'"@ !| Ĕ <8 ';` `  dd  d@2  P @  0"  .  2  L   ǒ? ` D@:? L*  &@  `$ L  ؒ@  !  ܒ@  !ܔ? ` D@: ? L&@ %"` U t x@; `H/  4 8"`8 8 4"4 `"  "` `  x"`| t$ x$ 48$ 88"`4$8 x$  | $ "  x" |H*o`՛ 0)0 D`    >. ?H` `2"`!㿘 㿘א (  c@oc, . . ?㿘 d@oܐ* @*`"@*`@*`&`@n d&@㿘 "   ?0$?0!<X  `" ` <!@Ĕ"@ $ ?" ǒ`Ē 㿈`?˒ D;@ @xR    2?㿘  Բ  <#<!@@  '& ā㿘wt`   2 "$`  ?0(!?0%!<X  $ ٷ `?$ !!<#<!@@ !  2`!!`2`!! x`"D; @ D  ? 21? @ @wܔ    "?@q 耦 ؐ 2D0; @w    ? X@qj @H<a@@m d<b<b<'<`*`*"* '''7H*/ @BD; @wz @  @ ? <\@@"" 㿘< @<\` @D; @?"@2?\ ! 2D1?;  ?򀠠2$?H<`<\>@<"@""@"` "<<#!(#aH( 㿐 D; @w    ?` D;@ <`@v    ? 㿘\@ !! ``0?(<@"< ``"  # H/ <\*@" * @"@H*/  " P 㿈 `D; @v    2 ?` D;@ @v      ? ` 㿘 \@ !! `2G?  @    c  86? ? , ؒ@g*?H/ <<!(` /<!<%<3<5<7<<<  ? # @ @ %     "$!  3< >#@5<?7<&a  5< >#@7< ?&  7<  6&?<x<`h<  @ _#a( \ !!<  <@? * < "a  <!$ <\<\"@#!$@!$" #!$`$& @kPa* !! : "@$!: $!d4 @l   !* :"@ $!!* :@$!<!! $! &$!@ < ,? ؐ@'( ? @@2 `a"   b"`l"    @@2< & ! 6: : & <`<!#< !<a%<'<&  )<+<& & a;` ,& `$& & & 04& , 8& 0`<& 4& 8& <& @& D& H& LH*o` $D; x@u    ?D@t   ?㿘<X` - <X  &$H*/ < H<D<[ *c"D 4 @ `H/ $㿘< X  %<[@    @bΒ /$ <[@@baȰ@ @ # HH "    :    ( 㿘< !  @     , `2  <<[̐!0 L  a, "@""  "@ # <L 2  2 " 2㿘< L  ?㿘U &@Q<     ) @2  "@ HH< L ` `@` *@8::`)    &@&  &  TdT4TDTTTl㿈 5`1?-?D; ?`` ?< \#\'#`@? ?@-? 2?pD; В@sz (  ( ?㿘 > k 2>   ?㿐\``2F?쀢 "C?;D   ? 25?@?2* ,   Ȓ  2%?  #\#`  2  Ȳ#\#`@  2D?㿐` \` `  " i?`#`#\ X4V   Q M0 /`D;D     `@ 8 `   @r `2)?D?'``?`  @8`  D;@ @r `? 㿘 @+j  ` &&  & < \&  &  " " < \&  &  "" <@b|㿘  "`  "<@Ub|@+㿘 J< )  , >     <\乐 H3@lk     @ ,`(@ ,   @  " 2& ,` 2`@ "$ ,  2$ &  "  2 㿘 '#<\  @" <  m`h , ( 2  , < 2  ,@Đ@+x&  , 2 㿐` ` "!? , "?   ?  c  "  ?'@ 㿘Ӑ 㿘ʐ 㿘 ";㿘  "'    @`s'< @  ;D @  @ ?`V* :   @ `@ *D@ :`  D;  @q^ `2@? *@ B 7>@kv  @ 8 @8`"D;  @q: `?@D @;@  . ? `?'@B > 㿘!<# @rff @rdx   \    @` '   2z<4"h;D  `?` `     D; @p 2Ű?,@'L@ - ܀`'ܦ  @?А k @\ @gܠ"@ J@  @<4"h @` X`2 $G<ѐ#- € =& 9& 66 3& $0 -&`'ܐ /'#<\@e`@^v@jz8 D; @pC  #$  `??T``````D;  . ? 0?`'<4"h;ܔ `'D   `?` ` `܀`` ? "'B>㿐#\ 㿐\@@ !! ` `` @ #\˚ ?x 'L      @`2 ('  (  2` $`5<4/;`j` ;hD  `?` ` ``| `   D@on 2?,'L - ܀`'ܬ  @?А U @[a ܠ"@ J@  @<4h @ D`2 $@ 0 `"-%@)`'%`'ܐ /'<\@]D`@iH8  D@o  "$@ ` k```````D;  . ? 2?``'<4"h;ܔ `'D   `?` ` `܀`` ? "L'`BL:㿐#\ d㿘  \ l?H G`D;    ? 2X? 4`@h 8 :  D @nw  2;?D  . ? 2-? ?' 2$?`  8   D;@  @nE " ?"? * `6\3" $0? (")  80   ;  D @  ``݀ 4?  ` 㿘5\D !;   ? 2C?`2@?   d @c|& ? 21? `D ' ? 2!?```"D?;@  @ ? *` ? *   * "@ 㿘@gȐ  L?\  E?ꀦ -D;@D  @  ? 22?򀢀 @ -? ?&@ 2%?򀢠  @mj ?򀦠D; @mW  ?/@ 㿘 L? E?ꀦ 0D;@D  @  ? 22?`@ -?  &@ ? 2"? @m    ?򀦠 D; @m    ? 㿘\ K? E?ꀦ .D;@D  @  ? 22?@@ -? ?&@ 2%?   @l ?򀦠 D; @l  ? @ܐ@?㿈D;D    ? 2V?f#0@  ? ?& 2G?F     ? 9?򀢠6? `: <\* bH `" `` 2` "?   d'`'\'D@ @l5   ?<8 4 d2  4@#!\#!`#!d 4 2 d<84" 4`" 4"\@"`"d4 㿈D;D    ? 2?f#0@   ?& ??     ? ~? "D\! !! `2Dm?@@k    _?D` @@k    P?D` @@k    A? ?`<  <\* bH ` ``2` 2d'?d`  d @   ? J0 .0"\"`"d㿘 !d!lp@x @x <8 p``"$ @ "@$ p `" @ "@ $ $ H/ 3H*/ t `<4 t+  `     `( t `&t 4֗1 11?!\!D ;     <"#4?` <#4 㿀<!<\<\` ''<'''yఒ <#4<\ /㿐p` <\!(#?<b @l,b 2 < ! `"!<\ !X @l+?<ڐ"w  <\!  @l0lHo`@'a'8 ?""堔+ 嘐*@ @ "H*o`   Ԡ     <"#4? @k֞H/ !!%%%* %*@ @ # H*o`@<\!܉  㿘<bĔb@㿘 I< E.`8 -<\+<\@  4@   b0@)@ސ@ې  @@   Ib@ɐ `@Ő@@`@ ,`@꺐2㿘 ` < @<\@꧐ 0""`㿘@ @Ꚓ%x " ?x'L' `(`  `?'@ꅒ?@ꁐ *`'ܺ?'`@u  @p <\"@h @􀤀 @\@ @V @Q@M 8 *`'' @> <\"۶@6 @􀤀 g` @@% ]@ @ 8 '  8 8 5<@9@  @-r@"2 <b *'< * @ ` @􀢠@L` 2@ @`@ji$  `@ ܨ  `R ?㿀@'D'@齒@'8'@鲢"@ 2  @ <\%#(@饐 ' ;7k@@雐@  ;8 8''9+ %@  <\#@|< @v,@%@ 4  - /<@?$`@c@a @\<"#2` <*b *   `  @-q  @.  2@   '@  '@ yD`T " D"`Tx''x@'L'x @8h']? " '@'ܪ8'@ %@ @  ;8<0`L@` 81/<@@"<\Y@ِ @Ԑ<"#2` <*b *   `& $p@, $p@.2$p@ נ    ܐ  '쀥 @褒 ?x@p'&@''x@'P'x @8't? " @'Ԁ'ذ8"@''@m ܒ& @  @ 'Ш+<7<93<@U@S"2 ⴀ@ b*` *   ` P@B@? <\ٸ"@8 @3"ⴕ2 * b*   `& $@,J $@-$$ à А@ @  Ԑ ؔ '耥@ ~?x@㿘@@ @,@㿘<<&@b2 <\#H]<, b*   `<\#O%x@Β@̒  @(t E ' @習 2 @(g 8  @<\@箐`@窐@稰@@磐0#@(K  㿘 @(x <@珐 8` 4`@熐<<$2 \*  <* `&    !` $`@+ `@+M@a@_@]@Z@W`1@( : 3`  <0@`T "`T<0 @c0@c<@:@8@5`@2@0@.@+@(@'F   <\#ؒ؜`@'ǒ ?㿘@@ B@   <] ؁@05@@@-@  <]@l @0 @@ @o@ݐ@<<&@b2  o"@@_@ΐ@㿘 , &@ $ @@洔 $   0// 0@桔ې@晔 2 ,㿘@( t " x x 㿘`(   $2 `@(@o@m03`,& @ @@`@'  0$@[<" 2 * <@*`@ ` $ @` 2@ .@`T"`T @?& @=@:㿘`<0@3  *  @' ?@a`@"@ @@T"T `@&  㿘`(  2 `ʖ= 0   1 2 -?`& @T`@"T`@@@<& 2` *`< *   ` `  +̒  㿘!@@弒@庒 "G?@嵒 2@@?@宐  *"@喐@咒@叒"   @倐@|@y  @@r㿘x@v 2   &0?  㿘<] \`< "<c < <`<< < <    @[> @Z d$  㿘x `@e̞r`, 8/`< 0 p0  @E$ "*$`<)`<#@& 8 `<@ $`( `2`<$4     @ 2`<$`<`<` @ew7㿘x  "?  ?0<c"`@? \@`@4?``@`\*  >#@ 8?:   "0?ꀎ" "۰? ` 2Ѱ?`h "` @2`"` @  `" $$ @k  "?  ? 2?ꀏ / <]?@  <]b @  ?$ a$$ `b  4  p4    4  2  ?# @p4  < b̑* @$ $ ,$ ($ 0$ 4@V c?`X*  ]#@ V   @6 H"$  (   ` <??"`  `€` `" 2 $ 0  $   @B @ `X6  $`X`\ $`\d0@   "  @ @㿘<@ /1/ 0x@$     㿘`i?@  ` W`` P` % `` VP6'  4 ' '`7 7`;&@'`' &&7 7`61&@%`` VP6'  4 '  `7 0`&@ `' &&7 0`6 &@&W 7 ?@T 'P` ```@#`    ?&@   #  #@ " " 2&@  \ 6  "   (  *        (     (  8 2"㿘 "J&   "@& (:&`       ` ` `(    "&     2  " <] &<] @& 㿘6 X" "X @@`\" "`\  @ @  ( "  0 `" 0@ 0 <]@8P<]b@09 @ 2& 2 ," & ,*& &&  & & 6 (&(  ,"@&, 0&0 4`&4`  "` ( " & `"& @& x@nx@k㿘` `" 2 `  `82   ` " `   8 ` ?2 2@ ٔ" 㿐/2?<"@o02x? "  @@: <] ?#@4u?<]b @\  k?    $@$  c@ "I * C   (  $@  0`" (" ` `" `" $ $"`$ $ "@$@X@Pݔ 2 `@4$ 㿘x` @aўWx `@a  &     P# @`2# 4 $ $ "b  2 㿘& & && T& X& \  "B   " (    ( `" @ ?&  0` (" ` `" `" $ $"`$ $ "@ 0 "<]@6<]b@2  `<]' p   2` ; ` 7 `2 ` .&` LH  P'H'L# `#@ 2# 6`&`&` "L  H@<]ߐ &` $   &   2`06`0  `h ?"` tx &` ` "`$"&`$㿐u x mj `0 0c` `4 4@2_`( (@2Z` 2U `@2P2 ,"   , `," 2C  ̒ `$ ` $ `( "   "  ```,"  &`,&` @ ?& `0`"`0`("` ` `"` `"`$`$"`$`$` "@`0 "<]@5<]b@`"&   & @ŋ@u@x@㿘 |) |#< " H ?& H`$"` "` " 2"  "@" c  $c "@ 2㿘 |J |%<'< *(&@  " H@ǐ  |?& H`$@"` "` " 2"  "@"   $ "@[ @/ <"" * , ,  ,  < , "@ @W@ @2 㿘 `" <  2"   "@& <c  ?"c & H|?@"H"|`"  "` `"@&& @ 㿘<b @TF'<%<+<* @*`  ! (b  $$ ( & *` *  *  *  : $  Q  @_x @ F`ad?`d @"O 6`@"5 0` $ <"<:` *` ,  , @T" @=w  0  <# <*` ,  , @Tr" `Q `4 㿘o6 " p/<]-<])<@8o6`  @ X* @&&p :< 2  2   @^ɞ  @^ %<"$ *` *  *  *  : * @2 D    @@U8@/ # 㿘 㿘  p @Ւ \`,@X<]b4`6`  <]X * @@` `2`` 2`` @^a` @^ 3<&2 <* b*   @^J $ $ `H $`H$ $ `| " " $`|<# `"# $  "` #$ `d`0€ @ 㿐'Ho`  " '& ` $@  < d " ` T`"<@" `܀ " H/``"`܁  "    €"` 2   @ʐ $@H` `2"`㿘  'H *` 'P2`<k"*` ` |* @H  0   8   & 0& 4& ,& 8 ( 0& , ," @*& ,  ,#@ & , , 8& ,,WH7<;<<]b 3 4 <]X * @@ ` `2`` 2`` @]T` @]s `̀ `  *` 2`<k"*` ` 3|* @ 0 0  4 :, ,* ,& 8 !& 4 & 0& 8"  ,/8  4 * ,0*"  & 8& 4   $f 2"<`܀ " 4H/``"`܁  "  4  €"` 2  4%0 8 , *`& 8& 0@& 4& ,& , "` , 8& ,` "`` "nd, "@" 8 b$@ *@ *`@*`@ *`@ :`*`  P@ @ i  2b,dH % @Β 2X,?X' 2 * b*  ` @\i`$` $`H $H$`$`| " " $|<# `"# @$`@`"` #@$`  , 8& ,d`0€ "`' `0€ 2' `  `  ",?' @ H <]H :  & (@2 @p%㿘  @Z ?& $ $@ @$ $ $㿈D;@ ?򀦠 <''''-耦 "㿘  L ! @[۞3D!D  ` !D @[)? !$  $$$㿀?t    *@``  &` ` ` `?`d  0 `h ` @2`"` @ `" $$     @bp rt? @   ,`@   $ a  [ W?  S  `N`h   @2`"` @ `" $$     @b3 31  ??򀦠`D;  ?"`: '<''''R耦 "􀦠 D; &@0m@0k㿘 0p    ,&@,@ @    <]x@ <]6` o4 @   <]X * @@  ` `2`` 2`` @Z` @Z؞ 7<  2   @    "d<"<$ *` *  *  *  : *  @ @0@U@@   ` * 6@` ,$0 @ }@ X* ` `2`` 2`` @ZM` @Zl  <$2 <* b*    @Z5 $ $ H $H$ $ | " " $|<# `"# $  "` &$ d`0€  b   m<d`0€    ڐ  2 X<@ @   @y ?㿐 0   `@? `$  ! L @YJ  "< @ @? &p ,8:D?D&!D  ? !D @Y'?!@/㿘<b&@* * ** :* < ` X'L@'@'P@"@ '8''@@ܠ"  `'̒ ''@@ <]@G!h@ǐ`'̒ ''@ؼ@ '@ @'@ 'ĺ 8`''''''9'@  @؛  <]!8@ؓ x @؍ئܨ @  @  P 8 'д ''Ȯ Ȥ *@s 7"O @l@j@gА@c @`@^<$@2 * <@b(`@ ` @Xߞ$  @G@E@B@@ @ @7P 2 @ے    ,$ @ Ҕ@ϒ Ԩ%0@'Ԁ @ '@ p @  '@ (L@" 㿘 㿘  ` @ @  `,<#od<`#<`8  h `, "h?h <"  "d? " ? 0 ?@ld &`( 㿘 0 4 ( "1   ,&  2' "$  0   `  L!@X;@. @X?!  㿘x?` @X/24xo 0@ -2,x@( xq  ?  ?@    2x  2x  x `@WΞp 㿘o6` <]@4  <] X* @ p@` `2`` 2`` @W` @WǞ F  @ 2@A?<$2 <* b*    @W & &  H $ H& &  | " " $ |<# `"# @& @ "` $@&   @Wƀ @ @u <     *   @Wgƀ @̒ 㿐   'Pd x H 2 P? " $' P @'` ,@ ?  հ"   P1<;< o"@ p<]b43  <]X * @@` `2`` 2`` @V` @W 26  % @& ?2 * b*   @VÞ $ $ H $H$ $ | " " $|<# `"# @$ @ "` #@$      @Vd P .b$ *` *  *  *  : * `D;@  @T$@$@` ?d H@ @V  #@  P&@@L oP :,@ 8$,@^ "㿘o<]6` @4` <]X * @@ ` `2`` 2`` @V` @V9 27 U @_ P@QO<&2 <* b*   @U $ $ `H $`H$ $ `| " " $`|<# `"# $  "` $$  `<]Ő!   <]ƾ! @U<"<$ *` *  *  *  : * 㿘<&6 . <* @   <]Ɩ! `<]Ɛ" @UԞ 5 #@( \ɋ@IӋ@L@9Ջ@<I@)L@,W@@㿈'x'L@Խx@Ը:^x8'@Ԯ'@  '3J'@ԥ  <]"@ԝ?@Ԙ 9/+%' @ԇ  <]@@y- @@o L @@h$ `  Ӡ  x@U㿘  <"̓*` @ G  2<]6 & b@   "?$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4& $    ,"@  & , 04 `$ `  "`  ( "x`"x@x @%<]<]b@   "?$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4& $   ,&@@$ ,4  0`$ `  "`  ( "{x`"wx@sx@ q   @ l  2@ f?$@ $` $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4$`& & $ `  ," @& ,`  ,"  $ , 06 `& `  "`  ( " x`" x@ (@xx  㿘2Q?o 0@ @G?2xC  `@S͞=x/ ,?(  ǔ  "? ?2* ` ?*   xÔx `@S D@1@㿘 2   @D <]6 b@   "?$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4& $    ,"@  & , 0`4 `  "`  ( "x`"x@x@%<]<]b@ >  "?$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4& $   ,&@@$ ,4  0`" (`  "`  ( "zx`"vx@rx@    @  2@ e?$@ $` $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4$`& & $ `  ," @& ,`  ,"  $ , 0`6 `  "`  ( " x`" x@ (@x@x= 2&2` \ _"\㿘\@ !! `o<?o 0@ 6?2x2  -??0' Ŕ#  "?@     xH㿘x?` @R/x@/`\ 0#6`  @02` 8 x<b2  x `@Qޞ 㿘x `@Q/@o0pp x `@Qž㿘\@ !! `4 ? x* "``x #<  @?Ȗ* *  " xɒ 㿘x`? @Qa 2x#?x2 `X 8xx<bX2 8x x `@Q]C㿘x `@Qc? x `@QF<;@X@\@d@@Ր@ؐ@Ő@㿘@l@h , @c  <]ې"@[!@V8@@M  <]Ő#@E @@" @6@4  @/@   @$@! 㿘@@"% p@ `p @ @$p$p@ @0@?㿘x`? @Po2xo 0 p@ &@xxג Ѱ? 8x "@8x  x`\#* &  ? 8x# @ ?x& X*` @ @ 8x ` 2  @2  &@2 "x "@'@2 ! <`2`" @$ x&`X2 "`X  @x`\ x"\ol?<]b @  c띒 [x8 U& & & &  & & & & &  $&$ (&( ,&, 0&0 4&4&&  ,$@@&,  " ( " x`"x@xzxAx6 `X "X@ "xx \@"\x@O?x `@O G @4@㿀<''@ؐ#@֠t8'5@ˢ"@  '['@  <];#@λP@ζ @C88 @%@9)2`@Ο  <]@8@Η'@Α /<]@@΅$0@`@ @z@& X*@  Ʋ  @_㿀<''@U#@Sl8''@H a? "@ ' ' : 8@/ +%   @58 89<]7@ # @ " ?@@ $0 ` ?  ͬ 2?쀢 "@    *@ 㿘 @Ȓ  <! @r  #d&08?#d      :# # @ # #@㿘 o <].#0"  @D0<#d  #d  "   2 <]#㿘/0<b*      ' ǐ @  <d 5  @)@:; &D  :`*` @ "p ;D  :  @* ` 2 "㿘 8%< '< ` 8  `` 2 8,` Z`&`@p T` `" #2`  0*` * *   @`"@MΞ`( @   @@<`l@K㿘<^!x'T'X <^!g0P<X<X <^!`<^!T @<^!J03X  T` <^"=0&<^" 4   <^"8*  < @Z   @Ej X`<^`"P& ,  a @o hdb !@``"!` " @AҐ @Bs @"@B "?@A@`2 ?$  < p   0?& 0 04 <#h *  0` (* , @($ 0 & 0 @ 0@?* $@@A@B&& $@ @B" @ 2` . . 66@AO  - 8- & <@A<& @ @  & D "xN*< @* & TTX#m& & & & 4& 8& && & L<  @LY<  L@5 <^ P2 L<`P< & P"`P @L,㿘 <X<^" <X <^ L."`6< ! @L<``P  `P@2 `P<`h2a P"`h 2`Pa @K<^"԰ 0Ea @KH/  $ "`" H* Ho` $ 2    2 @ H*/ 㿘v 㿘 <X<^#_ <X <^ Lt# S <  a @KE< P` 2 <h P"h P "Pa @Ka1 <^E#P$ .  <^@` #x6 @KU``P& P"`P @K7 㿐?#@ <^ L#`@ @2% <X<X  ` <^ L#``   Ho` D& D @& D <@@l $ `& (& $` 0`'@ ; %`@<$@2  0* < *@ "* '!2 '(??$!2$`@ @@<`l@ڒ @@%    * @` ? *@$$ $t   $ @ T@ Z$<$@2 *  0@< * *` ' "@"``"@J`(? '4$  ? 4 `@$`,`@$$Ho`)pː#+$ $$& "`"& $& H?& $`8  @@<`l@<$@ 2`  0*`  <+ * ? ? @`"@JL??`(@ , Ho` $?& $` 㿘<_ ``L<_ 8ݐ 㿘<_ @L<_ 8ΐ 㿘 <_Ho`)p #+@V `2    $ @`$  2  &@ &@`0s&@@?$:  @&@ &2  2   '2  """` """ "`  2  """ `"""`" & 2  '<_`=  H/ Ho``"0 hR`  I  㿘 `<_Ho` @L @@ )pː#+@a, 8?$ "$ "  " `0c` "&   "`"  $ $ & "  2& "`" $ $ "  "`&`<_ <&@2 * <*@ `  @=&@ * @@`<_ ٔ0 Z@<_<_ ϔ0 ʔ` <_ 㿘<cl cl@8`` <_Ho`)p #+@T `2    & @`&   &@&@ &@`0{ @=:  @&@ $2  2   %2  " "" `"""`  2  ""`" """" $ 2  '<_`  H/ Ho``"0 h`      @ `<_! 㿘 <<&2 + < *  `"<_ ``@<_H``@L` )pː#+@Y, 8?$ "$ "  " 0[` @"$@ ` "`" `$ $ $`"`  2$@ "`"@ $ $ "  "`$@<_    `@< a @E< -<_   H/     ` @@:   Lؐ@2  P` ڰ @Edd&@(@@@V@\@@ˋ@@ې@ސ@ː@ΐk@@㿘@c " @^<<$2 <*b *   @I, @F` @D ` `2 a" d` @@*@T@#"T@A m   ` <# <*` ,  <, @: W @@@"N  2J @`(   `@@@ T# T`( € ' t #@ "@ T# T @& @Ȓ@0@` @Dr @ @ג   㿐'H`@'Pq ex@äH`h''@Ø T@Ó  <_ " @ËI @Æ  @  931,@t  <_@l!  @e @  ex$0" lHP 2   2  ʦ     㿘ex l: "ex *s "   2 ex "`hex" l㿘<b @8m $  =<8   `4@<8  a "`4exT  ""hex h (`4 `4@2a "  2 ۠   ?  !?ɘ  㿘  (`Ԓ 2?  0@pw 2? 2?@Pm`ސ`  㿘 $ d$ l<_bp?4!’bp`<4!`  4! `( t,!$%$ $%)<]'< P`@ t 0  #   e$2`@ 0p< Г6` `  <_ѐ"x0`<< @   +  *  <]* `` .``,2 <_"0G` `,@`2@<_ "<_"<_# 02@ 2<_#0* $<_#@0#v4`*`  (@B b<Ж`'ЕH`` "'"`# `܀ H/``"`܁     €"` 2  !`-`-@Bv<!H` `2"` <_#`0  < @B^<aD`p "`paD`t "`t @B` 'خ)]` "6<_ `d`8 2`h`D  , `d D €,` >$ `<"`h  "@ ,   ؒ@U,`$ ' `%` Ð#d4`(`  @(@A<<_#< Y # @A˞06<_#x02   @@AО  @A$  @AÞ  @A-2@)  "h <_q#㿘< Г6  `@ <`e (0'*` *  <]* `` 6 ?,.@ <`S X00`(`  @(@A2<<_B#<  #㿘<&6 <.* @  <]""<`# $2 <` 0 <_#`0;㿘<& 2` <*` * ` ` @A4$@A/<` 0"` <`!0<]"`$`$`  @@  @@$`$@A㿘<&6 <.* @ <`!@0 $<`!p0㿘<<&(@.`@ .`@ .`6@ ?.< /@. >`. '" 2` ((?"` /```&  6 ~6`(` (@@͞ * @(  & ` "@"` 㿘    @@z "<<`J!"& * *  *  *   &  : 2P ?*`3 H`<*` < .`b< *#"  #`` * @*`&` @@+`""6   6 `*  @,@@Z , "@*  "`" "` &@ &` 0 +  + | * @"#@"`""`  !㿘<&<b6  <. b* e㿘 ||@ #<`` @?"`"?2|aȐ|@2` "!<`!㿘` 8  H`(J !< t#<`@A<] P P` @@  # ! t` . - H*o`  !! *@!Ho``@   U.`< " ,@@< F<"`# * *  *  *  : "6"0(`,@@?y "#" ,@ @<r # #" `6 0 (`2@" ,"@?X* * @ T# `` < " ,@ @< L<"`# * *  *  *  : "6"0(`,@@?& "#" ,@ @< # #" `6 0 (`2@" ,"@?* * @ # .  ``  㿘H`!< <`*`"(<tt <``"H`u/<`< b<`7<` ` "`  <`"h<`"pd, @*`@   -@3ސSx L∠ ݀ @㿘6  <* @ *`@ <]*` `6  @ 6  <* *@ * '<`," @. ` @` @> `*  2@ `* @& "? ?ް 㿘@ϐ 2 @  ] <"<$ *` *  *  *  : * @J <F?"<$ *` * @ * T *  "T  : * `& @ "`  $  @ ?@  2?   `@$ @ `@@@@ 㿘<<< < <``"㿘<`  "`$@=<"& *` * * * :*  <<` c"K   <"& *@ *`@ *`@ *`@ :`*` <<` K#3   @=V<]"o6`  <]0@ <<]c  X @ & & & *`#c  &  "` "& H  H& & | &"  | 㿘 4 6  0 < Ѐ -<]* *  * `` . `,2#*` `$<`%`3< ̔ `" <`#H ` 2@ <`#x<`#ג#ђ㿘   6   < Ѐ <]* *  * `` . `,2*` @ "<a<a <a @<a x 㿘<`   "`<"& *@ *`@ *`@ *`@ :`<a*` < { 0<]"<"& *@ *`@ *`@ *`@ :`<a*` < c!0 $@<Ɛ@Q㿘<&6 <. * @ $ 6  x  ? @?   Ւ 㿘<]<"Đ 4 @4  "+<])<]#<b X * @ "2  2  2   @<  @<< "  <a $ `Ȑ $` b<a!x  㿘ΐ .  ' = "<$2 * <@*`  D    @; 0X @㿘<` <ఀ<](`((`s "8 .& >(@0)!*&  . >(@02&  6"& & & (  "(``(?`0/.`( ` @(`((`$$``Ԅ`   0` (`(`($$u(``q `o(` 㿘 S6  P < Ѐ ;* * <] ``*  `5 <`$*` *  *  $@ #`.  ,2  $*  ##@#* `0  *#  8# <` "`<aÐ!0 <a!0 <a"0<a"0㿈'D ' 'L'P8'9@@%"@ `'w'@@  <a@"@l @@P<"@2 8 5)@%@O`@  <a@r"`@D@,@.* @"0$p@ސ L@ِP 2%$p@Ӑ@А$p@2$pDP@@@5L<" `@:HD`T "`T$p@ ͠    {㿘 <#  @Y 2 㿘. * <]* ``  . /<8#1<, @]      @`@ `N * @   < `",??"$ *` *  *  *  : *  4 <8 %x 42%x@g$L  ",#<a"<  `2"  8 \ ? !! ` @.* <ڢ< Ԛ? <" @@ 2 *  !  +` * ` * `0@ +  * <] * `  ``   ـ2 ?ꀣ`+` 0 $Ԑ * <] `` 0* `0"@`2 "` $+ UԚ?"<]* *  `* $ $ `0 +` *  *  * *  *  & `$ 0`$ *"@ *`" *  *  * " * ":$" `$ *"@ *`" *  *  * +`" @ *`* @ "*`: 0#  5$  @1 ` 7'`@ f   $ `€$`@C<   ( "@ $ "  v4  s$ $$ @C㿘  <]` `O?<ab@%A<`Ф  A 7 4 @GS<ab@%, `<ab<ac@% ,  ( $ <a 4  +` 2`@ +`c*@%*Ф àx 0? 5'\   !! ` `@0z< `<]   ``     4 2  Ѐ  %А ? $ ,$ 0 $$ 4 $ $ $ $ $ ?/<`ܐ?"`$ $@, <$ `< " @@ F? *-`4@4  7'`@ { 2 @s?< 4* a@` `* @`fЖ  ?<] ` U 43`* @`$ `* @:` @BЖ  ?<] `    . 4`,:   <a# ?$   *`i<a #P$ @3   <a#`@3| <a#p   @0 @/c $ $  :*  2@ `   "$ $ $ ,  $: , .*  $  , Z :*  2@ `* 2@ 2@ , :E`<a#?$ ?$ $ ,"}?#@*`$ ? , @/L*`   *$ ?* ?*2@ *  ," `?}2` ` ,<a#Ȁ`2 <a#а?l 2@蹐 G$ @/<ఘ @"<b $.`$ $ (<`Ԇ "?* *  `* $ $ `0 +` *  *  * *  *  & `$ 0`$ *"@ *`" *  *  * " * ": " `$ *"@ *`" *  *  * +`" @ *`* @ "*`: 0# '  "   $  "   @A  $4 $ $ $ <`ܐ "`܀k 㿘<ж & <&$<]` ,<].((( @:$l ((.`2  $&$ & ((`@  *α.$ ( ( & &$@<` 㿘#<` /<  "!<<b @  $ ` . 㿘1< 䀢 2 0 <" < <*` """ &   㿘< 䀢``ݐ 2^ ` 3.` < .   @)?@+ @ @ 8 .  $@     "2  @ߐ 2  & 툐" " $@"$  " $ "$ "  $$$  " $ $<`$"`㿘<  "  " 2 2<b p,06<"`` @ " *$"`    `  $ $$```   @` $`$@㿘/,/:  > 㿘㿘< 䀢` <   `  `@@`2`<   `  ` @`2`< <b<b@!b`0*`@!\<b`@!W<ba(@!P<baX`: @!B: <ba : @!4: &㿘@)' <  h  ? ` ` @@?㿘?t    *@   &   ?   h  ? ` ` @@ x` /?`L ! @4Kn' H'ؐ@Iذ  `d   <` @ @4X?!㿘@( <L < " @@ B?@&  < h ? 4 #0?@& + ,   h "  @2 " @  " $$     @:Ҕ  @&ϐ@>㿘?t    *@   $ A `;?`7<"  0?  ,c(?,  h `@ @ $`@ $$     @:~ *@x@( <B h ? 7 p`$'D;@  @ ? 'D`  `'?'찒 ؐ! ' &@  @&  @Hwذ@>Zh@' <2 `h ? ' p`'D;@ ?Ȓ@1    Ȑ!'''ؐ @%  @H=ذ@> 㿘`@-? 1 1\!\d!\ @'i < @%  `   h  2?@=1 1!\㿘@'I < <" @@  ? @%  p "  @=ΐ㿘?t    *@   &    ? <"  ? @%c   p `$p@=" @ې㿘@& <% <" @@ ? @%A  \@? !! `p  "  @=nx?t    *@   & + %?!h ? #?.`?2`#@" <  /@ A7'ؐ @GLؠ@ox@& <$ h ? #?.`?2`#@" <  /@ A7'ؐ@Gذ@=x?<b!0?h ? 8#4?.`?c2  "&.2  "(" F77'7"h < @   G7'" d$< @ ؐ ;`7'ؐ@Fђذ㿘@& < .`.22`@<㿘@& < .`.22`@<㿘?t    *@   &   ?.`.2`v2@㿘@= F?`  & $6  d2`@%א<2   @$ '  > & & (& `d " &  "  $ € 2  $?ܐ! @ & $ "@#@<'& @{㿘tt?`   `3 *`t   ?3 `"  "@ ?2 ?   ? 2 ?* ?   ` 2`` .` @Fѐ ` 4 @FZ "t0*  *@  # `  , * # `$`  <bi!`"@㿘@"ؐ<'  1| . t "@ { 0t6  *   * *# t`  "  㿘ϒ&㿘  ` $€  & @#;@;d㿘  <b"     `" @  @6@㿘?t   `. @. `"@t6 *   *  8 @" t *" `  "  㿘\ ? !! `؀  @@~@    ?` , :``@C? ?`<`@  08` `( 0 `T  㿘?t    *@   &     ? <>` D2  @ @ڐ㿐?t    + @   & 9  3  / -?    < @ `!D@`2  ? D; ? @-    " @㿘?t    *@   & 2  ,  `h   @2`"` @ `" $$     @5   ?   @I㿘?t    *@   & J  D   h   @2 " @  " $$     @5`& "?   L ! @.  @.}?!@X ?ꀦ.归  x?  ?D; @,ѐ c ?ꀦ  X T R `    h ` @2 " @  " $$     @5$ .  @rז!` ?ꀤ   @`  "㿘?t    + @   &         T@9㿘?t    + @   & - '  #    ! ``L@-    `L@-?!@㿐''?t`   *@   & 5  /  `h "` @2`"` @ `" $$   @4Q ?    @㿐''?t`   *@   & O  I  `h "` @2`"` @ `" $$   @4, (?  $ !  ! ``L@,8   `L@,؞1?!@G@@F@%@r+@uċ@bˋ@㿘<bb0@6<` '<b` @H@)  `<bbP@ <` '<b` @H@  `㿀 ?  . * @Ƒ2   .  . @ `2  @@ 㿘<b<h  ֔ 㿘<b<x ˔   < *  "# ?* ?<?*   ?      < *  "# ?* ?<?*   ?    㿘 <  . @ " ?@2 2?$@$ ?㿘 <  . @ " ?@ 2?$@$ ?㿘. 6 `6 < *`  `", `0`"( @ !<b! "@e@  " ,@<} ",<bt",2  @,`4`" @ 㿘 *?)2   &`   €㿘 *2  "   $€  㿘 *? 2   &`   €㿘!< #@. <b b2@Ӑ㿘+ 2 <`*@1< <b"#`<bc @㿘+ 2 <`*@1< <b##<bc @<"  <"  㿘!<"  )<"`"  "` "?" `@#<<0 "  & "0& T " & H& L&"#" &&  " "  6!<< c  " $"<b#P  "$@$ <b#p $"$ 㿘 `@"ې 6 & &  & H& L` d@& 2` €㿘 ?2& @16C`&  "` p"㿘 ?  & `"  "` ]"㿐  & 'H` 0   ,'& 0%< $@܀`" H/`$܁  "    €"` 2   ڐ $@H` `2"` ?& 㿐<"  +< bx X'* `S( bx. 2  9  `. t ݐbx  2 2? 4   `"   $ @&",  ?"  $  '  ( bx ` bx 8'* `+( bx. 2    `  ݐbx '  ( Ӑbx ` ` l 㿘. 6 @ @9Y 㿘. 6  Q@ @9J 㿘  㿘`@9`h  " @ N  " `  `"` @` + 㿘?t    *@   & / `)` % !? (  L ! @)    (€ @( ?!]㿘?t    *@   & / `)` % !? (  L ! @(˞   (€ @( ?!㿘 ?#@2( ( <"(2`  8`J  `2<<cx x"* @<co 2#`P#   8" 8 2J&  F# <b*@ < ?"@  (#*  " #  4`" 8 ""@" 4&"@<b& 4?"b 8<c 2 <c8 @?#@2"<c0 ` < 8"x"8 (*  @*  "  (* @""& & 8㿘  < "(2` J <*∐& ~& <c6 `2$& 8& `8& 8`8" "`8㿘 ?#@2 (<c <* bx 2 " & 8  " <cې <&  `8< & 8 #`8"  "8 (*`  "  (*   #  &#& 4<"p< *2 (  * (  l <bt * @@&"4"@<b& 4 "b́<p * 2 +@ ;` *@* <l+@ @  < t*       㿘. 2 є  $<" 2 * @<b(` @  & ` @'<j2  ( 㿘<<"xb    "&``!. 2    `۬   ` `<```ר 㿘< 6  #a@~.<c@<c! * `2*d2*w"2 2 * ! * @k  ;<"@<"   bx "Y`$U`7<c5<c 5I  "F    r  "   8  ) @& (  @ @&  @&ݞ @&؞n  p<`` 㿘@  @m ! ! " D" 2 " " @" (" ,㿘@  @& 0 #㿘,2 ܔ <  PN& ,"(> J #<b,  8( 2  8`J@ 2 <c) x?#@*<c!  <c 2#` #   8" 8 2<  # < \5  & 8& & 0 5 a , <@`<< ," ," ,㿘< # <2 b< .  :  *<2 "Ա*@M"* ?@@ 㿘. ߑ2  @㿘 ?#@2 <c!0% @   2   ( & (   2   <"<*`@@ 㿘 ː "<c?& s!Ё㿘   0J㿐. 2   `'  @~ؔ`     "  Pj`h. 4` <(2` J '  Z  @~<4`* a@' :2 * 8  ' @6  '` `   /  $@    ?@~y ,   g, '`     " S 㿘!<"Ȁ # <b< "bۘ0  H@ "<`$"& "㿘<b @1#<  bȀ <" ""$b< c͒   @ݒ H<bİ "b <  bȰ ?"$bȰ 㿐''!  <#  " 2 & $& & & & & (0x   <" #<h `%< '<H/``"`܁     €"` 2 Ho` "'$` !⨄ @  ?    H` `2"`!t!㿘@  @$' 0 # $<"@2` <*` *   n  n<c   @#HHo` ?& ` L`@2`   < "``2"` @"`<""A # @#Ԟ5 # @@#̞<` @# @#  @#  0 0<c^"0["Hp` `<cO" @# @#<"<&@ *` *  *  *  : *    . @#u`֒ #ְ? +<#6`H ` @#M`   `$@Y` U$` 6 ='`  Ԑ  @|`    Ԕ $@`$Ԕ`$@`$Ԅ  @# Ԑ ( !Ԁ "` L` ?$`  @# -  @"- "  ``2 " @|1U` @" @"՞`I #HH/ <"``2"` @"`<"") #` @@"<` @" @"`  @"   !㿘`!  @"~```@2` $< 0 (<@(`@` @"e0  @"rx `  @"1` @"O @"K`h ` : 2 `d 8?€$  `h `    㿘!<c<c"G  M ? f <  4 "(> J < . <<<`" #`8`#`8#``" 8"`#`` $ 2 Ⱅ* <b#`. "*#  "$"0"#а 㿐 $& $'  `   @!˞  @{2'& $㿘 $` %`` F!``@2` 3<b`&b@< #"<Аp"& $  ~  @O  㿐<"%<<c:` I"<<cD#<<c?#(<<c:#@<c@ #<c*x     ` ` ` @2 2` ` @2`#\#` cX֑*㿘<#X  <#P # <#T㿐@\ @0 <<"xb +<,`` I'7` ``  ` `' )'  2$'  ' 2' <!@,   &  `"  @z=", ?"  & ' ?`(  `<d 8`$,``܀ H/``%`܁   `  €"` 2 `܀ H/``%`܁     €"` 2  㿘\ ? !! `- ) &?: #?ꀎ <D;   <"ԓ* "?"*  <# <""  㿐 !d!l<d`P@ Ɛ<"cX ;<3<9<7<<"b( <@f<"x  ,@ X'<@"Ԁ ` ? 5'  20'6 ,' 2)' "&'   2`$  ",  "  @yT`  ?  @yI "  $ '`6`( @ `<d 8$  `  ` `܀ #TH/``&`܁   #T  €"` 2 #T# #  db(H/ wH*/ PLb(㿘 $ d$ l<d`X%4!’`X`?4!` 4!`4!"$% *@" <bԤ  ` $ $9@@E@r@w@<| <  *`02|0|  *0"## L 2 㿘 PP  F@* P&   6 `& & $& & @I<@ 5  "@&  <@2<<@k   "@ؒ& ْ <c| 2<<"#"c|c" L"c㿘<c| 4. 2 @2 L<# @ L#c|##L`"L@2 L < L#"L@(2 "##<c""cօ փ & P㿘 2 ?ꀢ <?#x`#x@@ " ? ` $ <x x `  "` ` ?㿘@<<0U #x   @  `B ?㿘<#x?  2 ?@   D;@  @  ?<x  㿘 ?  0  0 00㿘<#| <d +</<d-<d  @ <d!<d!@ \c`c @"   @ʐ@S   2 `@ k<d D`@ 7a` !<d@ .a `<d@ &a0`$!, @Q d<d@ a@`(#p@  @B d<d@ aP`,+ @6 d<d@ a``0 @* d<d@ ap<#Ƞ#Ȁ`)<d`@"   @_@   2``8@ ؒ!@ ԒL/_$c㿘<#x  <d!%<d#<d  a @  /$ 㿘<#x   @] 2   cx @K 2 㿐''Ho` 0 " ,'& 0` ! `}5 H` `2"`!㿘<#p#p1 `(. 2 `@2#  "  "  `"  `@ 2   "  `"@p2 㿘.   <#p#p " ,`2  2   " t <0 2  @?. 6 >  * ֐ (` #?D !D @ !D@l;''D@ @     ?㿘<#p#p  !<d  2   #!2 !<<#l#h@  !<U  #h`$#h@-!< <& @& <p @"&& "@㿘,2 `. .l 'ː  !<d!0  &!0&!$& 6 .   "6 6 & .  㿘<  6 (` @+@ʞ2 . 6  6  㿘. 2 2   (00<`*  *@@!<d"A i㿘 ,    ` ?& ,$  @&"@& 㿘 "" <dG"80&`㿘. ߑ6  a?`, ]" , ` (`", @, @'4 <]c` ` B  @0 < 7` " ` `" ` ` " `@ `  ( ,` !`  `@@+ "4`<d"X4``0!,`| #C6㿘@-? 0. 2 2  4`*(?<c\ @- } #\y<]c#\a*#\ @@-㿘\@ !! `2?@= <, <" @*@  h " 2?  ?h ?,   @% 㿘 㿘. 2    ,` @ 2 `    `?㿘  ?* 2  "@ox J@ܒ <C<#\ @K `"< '? #?,`2 ; ? ?  ? ", $, @%=\ @n㿘'H@*H` H  " H@o H-? "   2  @-ː 2 ? "   H "  H s ,_@ & "  "`  㿘@Q <  h ? ,@ ?@%U @$א㿘 &@: D 2x&@3   ".?`**?` "&?`"/8/ ϒ  ?D; @  &@  ?㿘D u 0  ?'\   !! `?` 0;@  @ ?c u0  {? s `@T `9@  <g <`" @@ O?`h ? G` C`*6 >?쭰? 9'  '  7`€ (? -?. /?0;@  '?#1 &.n2 c @#0 " . $€ 02 0zqϋ@z^@za^@zN@㽈'D  `*,`'P@m4  '' 'L?4 <!*` `$ `* @ 2P? ,`<   @6`<!+`   `*  :2`*  *` @  ?''#݀@'@86`̔ ? lP D gbP`(  '6`<* a@  /@ *?` 2 @:`@8&@4 @"  @6`,  $@  , @ ?Z ?' @ @qS 6 , @  B,  "k  P?0?c'@= $ B;@` '  &D;  @#A  @ D( DΐD`$@." @@   @@p  @@`   @` ` '"?Ԑ ?` `%  @p˔ @`   @` ` '"? ?`쀢 D "`(`? "㽀'D < a*2* @$'P`' * @ 2'P*@  ':  2 <!*`   *  :2`*  *` '  @ d 4$`#8 M@ 4 ;   @ @ )@;  E @ C  C?'@  D'`( '2*`<a@; @ ƒ<@ 쀣8@ 42 @(    2 ?` & 2,`"  `"䀦 ` @o۔V 䒢@b @ ##P'@B :'" D;@ $@ @ @  ; D @ `*@    $# ` `"` "먐 ` 2`" l  "   f    X"2 D "`(?㿘``*X @@ < ,`'  *2` 2 " ` $*  *7  &' (7 07 47 877''',: ` a2 @!2 @`*`$'' @''D;@ @  @  @  ?㿘@  <  d "   L`" @  @ 㿘@  <  d "   L`" @  y@ ~㿘?t    *@   &    d    L``@` Nꓐ㿘+?@  <%  d ? ( ` d    L` @  @) d (@ "<`(?@(? (@@( "@"(<((2  ?㿘`d B? ? :鬤?頒 $`   4 < $ $$ $ (`d$ `€  t.  "@  $4? t6  *   * *# t`  " 㿘  0t    . @`!?`  `$` ` `   < (   `"@?"鯐-  D; ?   ? 2 㿘'Ho'L D!D e?H.  "!DD;  H    2 "!DD  @. (&!D >?<? 0;5` L* @  o # L@L " "?!D?'@4  D  @/%@ զ ? "!D㿘a0%;?`@&a0a4<]@&a4ɵ  x 0!w$$ $ $ 4 $ ($ ,$ 0$ 4xM  x" 2 "X`    x`T"`T$p 8`d K? G貔  A` 7@   *@2( $  ?  D!D !DD;  ?    $€㿘x ` @z ~~x@tx0$}?   $ d$ X$ T.x!x 2$   @} }0!x}㿘`&.    ?$ `@ `&! 2v! k  @ʞ2!ʾ!!$8@2 ,@2,<`?$8, J@€ ` / 4J@* J@ `+  2$8 2 $8  @o "$8`k!t ` ,@  "@ "6 [6   `,  `*`0"!\!㿘! <   " @ @ 2?`I"? h`" ` 2? 2?`?@   2 $? &! h&! &&! @ d$2 &! (&!! " &!&!&! < `<! ? 2!?&!&!! <?&! <!!! @ `d @ @ 2     I&!< h "  # `  `x!\ @ `?p` `t` \  !! `\! !! ` ?@ ͒ !   , < ``@!d @!\11 1 11 12"8d@"h"8h (!h$2 (  /"J@  0 ( "J@ $"$㿀?!D  +<)<e `(! 2S?  € ! "&! @Q&! \ 9!\ဤ26  ^8"    ^8    ^8   ( ^(   @$`(X#8'"? 6" @| <g'2`''''' '@W2` '@L\  2 * U!\    ''{  'ܒs ' D   \* * @!\Ā ,`@ .` `І `.`\ *@!\rp@㿘     m?〦e $@" , `? , `R  , 2  MP  L>r  , " , `$ +  ,`"( #; " 8 4  , o" $ $ , &D@ @x@ ,`2  $ q ! ? @#㿘``    ?  j ?   L @ X @˞ @w>j _?]>R<\    `$@2L?r%  ,%&  `$ *  , "& %;  /" 84 @ $ , &D@ @ ݔ@ , 2  $ p !â <\"@ $ 8`$ 4@ @A @K "????2 ?D; :? ,"㿘   `" ,@ ,  A  "  " 㿘   `" ,@s ,  A  " 㿘   ,  < < h& 㿘   `" ,@E , < h&   A < h&  㿘      ƒ &  p? ! 㿘 & 㿘 & 㿘`   ?& `  ?& ϐฐ  ฆ༐  ` " ` "  㿘@  & ή <@!  !Вa& & & & & d6 "& & ,& & & &  <\6 &6 (@& <& 0& 8& 4㿘< k?7 d ]< &T 7 = @Ɛ`?@ "@$ `$`  << !<`$`  <4`$`$aX  $ $$ 4 t, ,"@ t " %`,%@t4 *  * *# t`  " t4 *  * *# t` :  "`   @ WUo@oԐo|@oii@oli@㿘  ,?< 1D  ?"/D; @?@ ؔ ? "? ͊ 㿘` " h ` <  (`@?‎`"  "29?  &@<  ( 2<   "( \  !! ``  < "  ?\  !! ` ?㿘 d@€ "  ? " @ . ``` . p   㿘@  P €  @o @ 㿘`  L@ @c @ ? d`€ "@ʐ L L @ 0 @  P €㿘#` d  , Ԁ `!d,԰!@0@?@㿈L /X "X@wXL /"`G` @ =`<e <e!p ` @ "@ ֔ < ϔ<(  p `@ "@<   @1@-`p  2 Lp "L &L wl  '2*   /2'$'쀢 `L /" 2` P "  € G 2`ؔ 2 `|2`   $@ɐ<!` ` ``d ?  `  0 ?` 0 c  " @㿘ː< y <   @?㿘p`@. `? jj@ @@2 <<eа! `b[J   h"V ? " & `L@ +& 2  @2 ?`L @ @80 h ?  2 d` ?` { `L@ ݞ@ p l?"#< @(@e?@?뀎`^ X"  02hh ? B > { ? `3!?` +d)d( !h " @2" @  " $$ @e ' v "@㿘p`.@   <N "  $  `L@ \o "?  @"    ? ' 2   d` ?` .2 `2    &  `L@ @@E@C㿘<@ >?\@ !! `.<@@?4 `" 0@ 0@0@< <.o2 <@ 㿘%<M p <C "  $  `L@ ` "?``@" `     2   d  ?  ap *@    `L@ {@@ɏ 㿘` `  @??S  : !6? "" ``&  @  & 2\   !! `? ?``#"`" <  ?` @?``@ ? " d "?  2@?  `@F@ 2  d` `"`"&`&` d`€㿘c<\  <R  L? `"@ $@ $` `L L@ "   @  @ @ ?  @" `R  ``L L@ @  @ @ސ@ܐ@ڐȾ 㿘` <?`  @7?  2 !-? "" ``&  @  & 2\   !! `? ?``#"`" ?<  ?뀢   d` ?`€㿘<6  <, "  $  `L@F`  ?``@"    `L@@P@N2 㿘t<Tn<K  <A `"`@ &@` `L@f @ ?  @"`  `? Β  2`` d` ?`` `L@ƞC@@ڒ ג 㿘<n<e ] |Y U |O` "  &  `L@` .?``@"*  "& `  ? f `2    @? #?d "      `L@T@@@e b 㿘`@  `D?`  @?!  : !6? "" ``&  @  & 2\   !! `? ?``#"`" <  ?` @?``@ ?   @? 2 ג D @@?Β  :!6?"" `&  @ & 2\   !! `? ?`#"`" <  ? ?@ ? G d "C? $ =? `  5  ha$@@ ? "  d@* ?  d $`@Đ 2 h@Ԓ h a$@\㿘`@`<?`  @7?9  2 !-? "" ``&  @  & 2\   !! `? ?``#"`" ?<  ?뀢 2i  @"b? 2  <  @7?  2P!-?"" `&  @ & 2\   !! `? ?`#"`" ?<  ?뀢 2 d `$ ? " h   @  @ 㿘`<`" G0Y㿘<<} = |q` k? "<  @? * |\` "`  $` "  &   L`L@ "   @d  @\` ?``@"  2  @     `L L@(@  @@P@N@L@J- * fѐ[@fs@fs@f֋@f@f@f@f@f@f~D@f@fy@ff@f^@fac@fNq@fQ@f>@fA@f.@f1@f@f!@f@f@e!@`HP0㿘? t   ,@#@@  @E     @͒    #t@? ?  ,@   %  @?@ <e!(tʒ6`*  @ 5`  "@?2 `?   @?` 2@ ?* ?     2  ` 1 @Ȓ    @P    2 4 *  * @#  *@"  @  $ t,  "@ 㿘 t?   . @   %  ? <e!(t54*  5  "@?2 `?   @?` 2@ ?* ?     2  ` 1 @3    @    2 4 *  * @#  *@"   $ t,  "@ K㿘`  !"`$!?`$ @` "  ,6 2 `$?Lc  &`$ 㿘? t @ +`@" `   $ `  <B#D.` €t#??@ +`@  $ ` ?` <e!(sU`6`*   5  "@?2 `?   @?` 2@ ?* ?     2  ` @1@ @S`   `@@ے`   2` `6`* ` * @# ` *@" ` `$` t.` j"@ k0ft3``*  `2@ ^ ` 3`t * ` * @Q# t3` *` ` * *F# D$ > @A9 @3 @-+<$<<4@04B`"  D ??$D < 0`" ?@J  <8` 4`5 ` ` d @2) 4" ! "  !   2 4 ?`7'' 'x'|'xZ " 4 \;  4 Ѐ`㿘 "#<e" r,aH0 `< `<   2㿘  `"Ah`" \S ""CDL @ !! `2dK? %8 2DB?;    ? 48€ D+?&0'2D#?; ? &0; :?, " &0 " ?   ?㿘?t @   +`@   $ "@  "@"th  b}@6b~@"D^ 3` * ` * @t# t3` *` ` * *i# ;   ? [  ` $ S$ $ $* O$ $D;   ? @`  $ `@@ @   ? ,   *` $ @%$ $ ?"$ $ ?  2 "?<  2      ` @Ր㿘   0?& ;D  &D   &   6   D @ @i D  .  㿐?t    *@   & 1  +  ''' !?  L @Ȟ <F А @`6㿘 ? ?ꀤ & 9? #;   D :$ & D :D$D  4   D @ @ D  ,  "& & 㿈?t    *@   & B  <  8'''' 0? , L @?8 <G  @0`쀢D @;@ : "&}`ːK@`S@`ċ@`̋@㿘 2  & & &` %  "  2  $ $ $$`㿘 3  *&@` ??& H/`  ` 2"` ?  2? 2  #*   "   H/`@" "@ "㿘t ?7 / (*   @ / ??/   ` / 6`@ 2㿘   s , l?   !V @4,` `-  `@    "Ct    ,@     E  €  ,`@@  ! `  @  "@ !  ,``@  ` @  "@  ,``@ " ` @  "@ &@     ]! "&&x#`,'D; @  ? @ ` 怤 ?ꀢQ" cc@, @*`@*` '܀ Ͱ?t  4  2 , , ,  ?,  '''''`'D;@  ? @ 2? @g 5䀦* D;  ?   @ 2?  @K w5耦* D;  ?   @| 2?  @0 \5@**` 4 , @$@!ʔ܀`*X@& ܢ   d@@6 d/ * "* * D; @ D%@`  %` ` = `5@%*5@*5@*㿘   !@,# t    *@    E " €   * :  @`"4   4 `@ ؠ      \Ķ!㿘  t @ G?ꀦ Q" @]  #?V 3 .`  *  ?D; @ ` 6   2? I㿘` O   <?<? ,&`  ``&  ] !`$@2$  2    &  `^j  2  > ?  &  ]] ! ^U   < h&` t ? B& `$@< <c? &`  ``&  ]2 ! 2    &  `^"  2  > ?  &  ] ! ^    3 ? & -  ] !(  &`  `` &  \ ! ]     &  \ !  ]ܐ   0 2     L   `"?& & & ,&  <d" d" " " " ," " " " " 5d5|555555㿘`  <e``(!`,k`%`@  ` " & &`&` `  `  "`"`    㿘Ւ㿘` 㿘 2 0ڒ 0` @`\] #`"  ['! 耦`P?t    *@   & @6 ?Հ ?   ` `?@͐8D;@  ?@    h?* 2  b?t?    , @   & Q  K?  G C@ <  8  1`Հ  @ 7'(c', " (" '7 %7D@?@    " υ8D; ?@|    }t? @   ,`@   & l  f? `b ^`h "` @2`"` @" `" $$2`x I? @ A??* : `&?<K#ؓ*` €  0   * < 2  ` <e""(j   ?  8  ` `?@AP  p`%p `$ " `2    8 @ H /Ր@?  p@`2 `$P  p`%p `$ " ` 2    8 @Δ H /Ր@  p@`2 `$㿘 ` p   $ @ђ " pt$""?2$ P H@1 /'t'` '/>?<> /Ր@?''`p "2  $ )@ $$@2"? @ђ ے[X̐̒ >`" $$  `p 2 $ 㿘 H@ .`$V 48 &5 .`%V "     ( " $  `,@,   @?&`, 6&`( &`( 2&` #&`,&` t &``&`㿘 H@ ` ".`%" .`%    .`%# &` .`$&`,&`&`( 㿘`$ "  `@  ` `? @㿘`$ "   ` @ @㿘 ,`(@ `, (@6 "  %  <e0`% `? h"x   ``@ <@ +  "'   "   2  2 @     ٖ2  2  㿘`%   `?` @Z?@^ S pp  $  `    @  $   2 %`% 1   @k`"p'` ">pQ ?iZ `}  $ @/  ``` `@@ "` <ef;! <e` <ef2!O㿘   @ @ߦ ϰ? ̀`% "*`p`p "&`p $  ?% ? >Y``p 2 $`p s` $ "` @ `  `?"O %2 ,`( ,@&D`, ( @O@ $&`($ ( ,`,@6&`,$ ,`. `( &+ (`, 7"  &  -`@  `( $ (`,$ ,`%, %`<$ <`@$ @`D$ D `` @ `  `?2`%`  `% %@3@R 2 `,@'@E `,`%( `($,  o j㿘 H 㿘  H@`& `& ` & `$. $`%. %`(& (`,& ,`0& 0`4& 4`8& 8`<& <`@& @`D& D㿘<b&` &`" "b&@&`4`@㿘& ` "` "<" "" 8`"@7 `  @@ " <ed! <e  <edސ!㿐` <  ` <eb@~ `$$<e"<e"<e"h " @2" @ <e" $$<e<e"Ȗ"@Z<e@Tb `%<e`#<e#<e# @F g#<e`c`(`,#\@8`<e`@c0` @.#\㿐<"' ] 3<ecP@ %  "@ @ $6"@@$  6 `".-<eXg@%  "@۔ @ $6"@@ϔ@$  " ` @ْ`2'&㿘 h "  @2 " @"   " $$2 㿘`h  @2`"` @"  `" $$2 㿘?#?@ܾ#<bĀ2 <f 2 bĀ㿘 w?h P "   `"  @?Z   <b`?"`` " "  @9< , (" "@  8&   8"`"& 8& < P    € P@  P   `" @@ @ `@"<] <]c4Ȕ" & <#`b`<@"Ȑ "`& X&  &<f`@  @eA 㿘  @ 0 0@"@v     < "    ?   "`"& &  㿘<` h<"Ш  " "@   ?$ ""`""P%"`?%`"" 2H " "  (" "@   $ ` 8" "$ 8$ <   P`?    € P@  P   `" @@ @ `@"<]ڐ <]c@"@@?"%2%㿘<"Ȓ"Ȁ   4 "`"b"""#bȀ ȐȀW<"Ж  TL I`?"`" "@"" " "@  (" "  $   8"`"$ 8$ < P    € P@  P   `" @@ @ `@"<]` <]c@ȐȀ   0 0@?`0`0   2؀  (         0 0 @`0`0񀢀 ؀ "  ( 㿘  0 0<Ȃ  `` &  & &` 00 2؀ ( ۸㿘0ϐ ?㿘`   <b@Ӓ?㿘%<]Ғ  2`F    ?  2 @`8  `@@-`` ,@ $$ $ $ $ T ( &$  T 0$ T 0" $ ("& 0 ($ ,$ ($ $  $ $  $ $$  0$ 4$ 0 8$ <$ 8$ @`$ D`$ P$ H$ \` `8" "8` "`"㿘  <f`  h& T& 㿘< X`< 4`T2  < \ * @@`?耤.@ H' $`P "  D  @  D @@      &  &ְ?   <  X2`<  T0<   \(@" 耢@@ <pp" ", 2  㿘    8&   8"`"& 8& < P   € 0 @ݐ 0  "`"& &  < X2` H< T0  < \ ( "" "`"㿘  2 <fbv  ` " #`"`& "&`""&`&` (`( (``" "@ ``("`"@ `@@ @"&`@& @ ` & &`  D`D& D&`D H`H& H&`H`  0 0"`&`($" 0 `0`0" & ($"`0㿘p@ .@   @  /<fa@Ô  /.   D  / @&@ @籐.@    D < @ 㿘p  ?  @& L  ?$@?ް  D;  @^   2?  "  㿘` @  2` *`@@  &` P "  € e  `2`h   "  < "@ < "" # <㿐''Ho` l " h'& l` ! `P H` `2"`!㿘<#p#pI`@. 2  @2:<`2 '<?  #` " ""`$ "$  $  h "    "   `" @  l $ Q #`֠? p2㿘<#p#p? "7<`"2'<?  Z#` " ""`$ "$  $  h "    "   `" @  l $ QT #`֠?cp2㿘 h 4<f 2#<b  " "  " "b"`& $ $b  &  h "    "   `" @  l & Q # 2 0`c!㿘 H u  " h h " &   " &  $`"& @& 㿘  %<ې?` "$"@" <c`"`@ ?h 2 2 ?  #?"  " "# "" 㿈''''<ѐ"`<̔<    "@   "" ""#"`  㿈''''Ԑ u㿈<  ` '''':)< ' dHo` d "'% d` !O ` H` `2"`! $`& O z"$`$` dP #㿘㿘<<]#  #:<""2L <fF!Ȑ   2  h  '< a@u!!`h$ d$?$?`$ $ $ D$ P>p" $$ $@a!& l&& & &  & X& L` %" :`?<""2 <f!^ 0?$ " "@㿘  h2 2 "  & 㿘 @  6 $ . & d& & ,& @   & L㿘<""!< c""`??"`< " & <"`#" & h6 ## & & & & ː0F < 㿘%<@0`<@c""`?"`< "$ "`" " $$ &$ h 4 $ $ $ $ @€  l $ O #0   e  " $ <"`$ " `͐0 㿘!<%< # 2 *h $#  9  `?"``$# 㿘 "   &   㿘@2  < * `h      {0X㿘 ږ  h<  `h 0( ""     "" 㿘  h    2 "   `" @ ? & V $  " "@&&  ` " "& &    &  `"@2    " "@& &   & <" & <$ c`" "` 2 p < "`#" & "" p "  !<f ." ]U  @"  !<f !"@ ]H   !<f "x ]<  L  !<f  " ]0 L X  !<f " ]$ L  @ !<f #8 ]㿘 d 8 € < `"# < `"@"@h2@P$" " 2@`"@ `2` 㿘 h`" ` $% !`` (2 ""  h "<   h "<\  <\"@ & 0(㿘@2  < * `h      '   <V $ 8  4  & " "@&&  " "@& &  `"& & <" & <&`c`" "` 2  <"bb"& ""b 㿘@"p?    &@2\`  \  !! `Y c`  ` (@ \  !! `A *!  &@`\  !! `-`" (`c !\  !! `!` ;6`"  & " \  !! ` 㿘@```6 &``6 (`` & ,` `& 0`@`& 4``& 8" ` (c;6 " 2 \  !! `2  " ;6 " 㿘<\ "@@`&`&`a"&` h "  "  € 2 㿘  &? 2 "<\@<`" d" 0" 8" 4 d<``?㿘. / 0   08㿘 *`<f[?#`0` T0 a 0㿘 #@3?@/ `c !,`$@4#@` ? @` $ $ .`@੔$@*`@G  㿘 & > /R 0  E 0̐㿘` ` : <fZА#0d0  0㿘#   N?@ K# @,`# @ 4#@@4? 1@, @2 ` :`  :@*  :@!, @ῐ@ἒ $$ $ 㿘/o0p "     㿘/ D; @ᆐ㿘<S#Ԡ` `<[c?    ??  ..`* & `"  " &? &&   ?&& ? && E ?&&  &  &  & ,&  & &  & \& $ & (& , & 0@& 4 & 8& < & @& D & H& L & P& T&`& ?&?&?&x" D;;#&D  @`'@40   &x "`L "H3;#'D   @Ð`@    'x"`P㿘  ?* 2 'L    ?  ` d  ` *  ,* 2  *   ٘  vӂ q?t    -@ " ,  %  ,H @ 2A` `@ `( `2   `"`( o  ` p` /`#@|,`  "@ `  8`  , ` |o 0'    \ L" =͐㿘x "`,  x"`4 x"`< ! ?!  ! 00" 0- ! ` !   #@ # @      #  / p      ئ'H  ''T 'P ' ?''''' '$'(','0'' 'X<f#OJ#@ ` OJ@ ` JOÐ" А?* 2  Ҁ   `d " "  yꀢ 2쀢`rh@܊ m  h? ܔӨ  l P ft    / @"'L  & 'L?L@ 'H'D'@z  2r쀥 :?`6@3 1  5?  l '<f*?c@" <fc@ 2D D` !DX !X b !X [ !Dْ    6  '' ''''' '$'(','0'?h'p't'x'|'''`@ 0j! !  2  2<fJO@㰀` OJ@ ` JO" ?<fW-#  2<g``@є`  '\\  $$`$$ {C v`x"`4x" ,x"@ ?! !X!Xx" Tf $x"`@ФD !D@?@ Y  Q `@ `2`2 `P "@ `@  0 o #@ cP` 'PА" 'TT" @'TH@ 'HL@@ 8'L D *'D@ *'@@8 `@ !DL@H@D@'L@'H'D '@hɒX <gVg | |z"a `` ` @p ` "H `   `@[H ` "SX!<#`!H  `` `@. ` "H `` ` @H ` "Ӊ ?! $(X@ #\#`  T $ ?] 2 xx``D @ݐ $`DxL "<"8xD",xH"(x@"4xm"@zLX @ H    X H  ## # #  ; ; ; ; (; 0; 8; @# H# L  ?  ݐ X t   ? ? t+  @ ``  $` ` `!D`  4?? 4!D |<fJ##O   OJ@ ` JOÐ" fЀ c쀢`Ҁ ] d Y `TR*   L?ܗ*ј  ?  *`" *0 2    o  #@ p ~(  p @ 8   @o p "    ~  e㿘 !  `L@   `?   `L@̞?!㿘  >`   @" 0>`>  㿘@L   ?  ?㿈@A ' '' 耢 ``Œ     `` @  \    ($ x    *@x!\`<g @`@ ///@ۋ  4  777''7'''7777D<g`H!D@Ҕ b/!<8!D  R$`"<  ڐd "֐ Ґ  `̀3 "!$ 4 ,` 4p@@ |@= . !<g:`  P''p't'h'l7 d''`'|'x `''d''l''@'@F d* @*`"@*`@*`'@ d'@7 d* @*`"@*`@*`'@ d'@( d* @*`"@*`@*`'@Ӓ d'@ d* @*`"@*`@*`'ĢȒ` @@=?!D`H;     @ @!D@$``$``$`` $`$`$`'x | p'|''   8 2  `` /p<g X /q ./qOq Z`?/r ?/s't7x7zx!D H`D"`O4 Ox`  DD @@”  – J ", &J ,!D @U %'' P'' '`  !''''  hm@?` T 'T'P@'X'\'`'d'h'lP  o,x `A! ` `'P'T"@`'\'X`       `?   'd'`` * 'h` @ `'h` h 'h v'lӔ "p` `2`  h ` `!D Wx`J ``  @  c   @`? "4` ``@:/` 8@@`@` "3!D@` ".!D@`  @2 $ "p $v `&p@*@` `2` @<g `R;! !DC d@Bo@? @ 2?! 2?!  \$!$! , @ʋ " *  J  2L *L  J " "J 2'p^? 'tJ@x !, p /'pJ   J J "* "*J 2't@{! ̾ !$$!t ` $!$t ̱ !$$!`$!$! ̧ !$$!  $!$ d < $! _ j㿘j?㿘.`: :  @.` >`@  @ < X 2< X  .@< .@  \@ !! `? tt㿘 &?D;@  @  ? `? <  h,  6 y? u? o? , 0@  .# c? _?B $ <<@" "@ 4 ,  4 .c  7?`& ?D @ @v &h,   ? <\6&&"@&   2 $ "$ b (4 2@ #An$  쀦#" . ,%%#"4 ,4 .̐㿘   <`h* @ 2???  !$  3  ( "#`  2`   @& 2 @$ `e(T` "h? 8 @   @<\$ << $7; .@<\<< $7;0""2" @"$  .*` 4 .$ $ "@ $ b #4 4T`" `? ,# "@4 ,D@:?`&@ 2?  `D@`@݈ 2?0 2 ? 2?A (T 㿘㿘+㿘<# < h,? ?%<`hAi@??",?㿘+<`h   >??"@ 8   a`h"@< @< #.?4 $<4 4 c<\4 4 4 04 $ $ $ $$ (4 .4 ,4 44 2$ $ <"@ $ "<`h`""< @ # . 㿘  0$? fb?0&?< h.   .` ?:` ? * 㿘<`h.  `<<<``, 4`" 0  < ?*  #c. `h?" #c`$ ` ? #`$? #>~`(  @ ``(`$  @ ``(`  1<#&# #@ *?ꀦ`'` ?<f"*` €< /ؖ( '''''7` ' '<c<<'#''D; ?@3   <#<# ?< h,  !$ ܰ? ;* ' ' ' ' ' ' ' ,7 .7 07 27 47D ?@ 8  8 "0D; @ߔ 8  8  < h,`   ? 4@?`"9``m?0?!$ }?;' ' ' ' ' ' ' ,7 .7 07 27 47D ?@ۖ 8  8 "U 0S? @ \@ !! `?@@\@ !! `.?4 0Ĕ4 <\4 ̰  a  4 @$ ? @ \@ !! `~ Hd,T<44㿘<  <"h,? ?%<bh? @??",?㿘`<X?@!@ /<h     `B?.```,?"%`   `h"@"%`< =ؒ #*?@r ,4 $ $<`4 4  4 4 <<\4 $ 4 ( @ $ # <h`"<" = # . 㿘`.?ꀤ  p2 ?&<?"h,`  (@  .:`N ? * 㿘.(,;@ (P`@@2(`( &@&@`" @@` ( 6@ 4?ނ`@*@   <\@ %" ` ?@ ;@ . P`@@ &@V&`" @` . @`6@@:@㿘  +  #     $ 4 < !`2   $  $  $ "@` "`& $  2   *` 2` 2 P6"  2   *` 2` 2 P2"  2 㿘<bh. @  <<<` ( 4 " 0  < ?*  #?bh. " ` $?`#`?"```2"`   ?& &  `  㿘 4<2  !`h@  ,&@ @ 06` @]  4.`@@R 2< n @^ 2 4G?@R~ @  4@Rp  ې<` ?"` < "`@RZ@RX 4"@?!`@RM!<" 2 * @<b(`@` @Ϟ@R=㿘<` @ I  "m <p< h*`    +< $`t p<`$  %`t% p(% p `t 0 %`t 4*@R `<@Q<" 2 * <@*`@ `!<`0 "`0_) @Q<" 2 * <@*`@ ` `t 4@Q"@> @Qϐ{ <<4  `?"4# %㿘`@Q@Q.`<& 6 <b.@(` 4@ `"@ @8<`"<` ?"` 㿘< h  ` (`0 @< h+` 4@ 2 0  Ô0 `@*3̐@3S@3@34@3@3@[`[lm<m<m<[|_d/h777p7777p7777p7<7<7<6*..../..../.....d)****V(****V(**h*h*h*,H((((()(()((((((HVpVp \ 4 ` `           h h h ,TLTxxhT444p p\\H7<7<7<d`pX@[[[@[[[@[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[89:[[[[[[[[[[[[[[[[[[[[[<0L[ [th[)H*/([PRlW<[PRlW<[[[[[[[[[[[[[[[[[([[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[F[LLH Kt[NxIPKL[[@AC@HXPXPXPXP`hp (0x8㿘d   ;D   `?`&d8@&d ! `$ $  dd , @ d8@d 2  ?d# @&dd *@&d&d'D0~ h'L'H '8'D0F<v`(?!=!;!9!x7!5!3!1!/ x-!h+!)!'!m%!#!p!! h p!H! H jD2  <vD(   H#C p@D(3"@  2 L `@"@"HL(@ 'DD>`>L?   0'D''''0&'@@' ?(0&`?.`( ".` @?'@'HD   80880220 2202FE    80880220 2202#` `  _  80880220 2202``` `"8+& ` D  />+&@ .&@?"D `>+"  / .@0( "?.( "&@. @? '@'H 'H  'H 'L?`0('`0'\f, 4`,`\D<'\p'd  4@,M,@c "?  84 8?802?20 2?202#?"?@  @84`8?802?20 2?202? ? `?,@ \'dD '\D 'dj> e'd b' _'HD 'd`Y>D '`S>L?0('0'8 @-`D'' =>`?@  @85`8?802?20 2?202?? -@D ''>D `' > @' '  LD`H !HL-   @ DL>' D6>6' L?   0'8''''0&'4@' ذ?(0&`?؇.`( " .` 4?@'4'<C   80880220 2202FE    80880220 2202#` `  _  80880220 2202``` `"8+&  D >' 06 ز +&@ .&@?#D >' 6`+"   / @.@0("@?؇.("؅. 4? '4'< '<  '<L? (0g0gh*3 + |D>' 'Xѧ2`  3*M+ f"?   82880220 2202#"   83 880220 2202` ` + D|> ' 'Xw3D> ' 'Xo6` j'Xf' c'<D> ' 'X\0D> ' '|U2`?(00'x: @+`D>'x' '|@6 `? @  @83`8?802?20 2?202?? +@x>' D 'x'|6D> ' `'| 7`@ '|' )  D(6 D"6H`@ "@H` #H`&L(@'D6><u(|. <u(x   ` -@@ 5@2 x'l  ` +@@ 3@2 'l't@ 'h@'pl `5` 'h'l@ 'p'h<'p丅0 @'p'th?#@'h'ph  h82 8?802?20 2?202??l"@'lh+'h@@2'p'h'p'p'h 't'l'h7x'l|'h'p't   'p't<@'p丅0 'p|'tdX/`2 <ux(\@#` `8`  @ ,4@  ,@,4@@ 4"''L  #'L`8 `  @ * 2@  +*3@ 2\  \'L`'T@ D @'P1 ) 1L`'L`@ d 'P<'P丅0 'P'Tb'P"?  81880220 2202#"  81 880220 2202` L `Q'L7 2'P`'P'P   'T\'L`d'P'T'LX  'P'T` ` 'P'T 'P'T`< 'P丅0 `@H<. + <u8(@4o  t\耦  8.&    .``@.``(    @-`..``&@  `   @...`( 0`'@.`0"`` .``` 耠 @ ' ''''4n'(j t\؀  8.&   @ ذ .``@@.``(@   @-`.  .``&@  `   @.  ..`(0`'@.`0"`` ؆ .``` ؀ @ ' ''''@'(D'08>D',ظB@'''@p'0 ((   0(&Բ.`0``" .``` Ȁ@ 'H'(',؆b@'''Ԇ',<8@',丅0 D',#'0` ԰@@b ''''8',Ԁ!?  808?802?20 2?202J?I?Ѐ   808?802?20 2?202?& ̀" _?  808?802?20 2?202? `?( '(  8/ & `  @+ȴ / & .`&@?` @ȇ/ "   ..`0(#@ȇ.`("`mȅ.` h1< @ 'D'',' ''8','''Ԟ H'0@ N'(4'(''8','<'6'0D8?D ',,'08 ',''0D<8',丅0 @ D@ <',|2|*  ʰ <u(x   ` -@@ 5@2 x'l  ` +@@ 3@2 'l@'t@ 'h@'p `5`'hl'l@ 'p'hp< @'p丅0 'p'th`?#@'h'ph  h868?802?20 2?202??l&'lh/@'h@@2'p'h'p'p'h }'t'l'h'pu'tx'l|'h'pn't 'pe't 'pa't< 'p丅0 @'pR'tX 2dX.` <u(\#` `8`  @ ,4@  ,@,4@@ 4"''L  #'L`8 `  @ * 2@  +*3@ 2\  \'L`'T@ D @'P1 ) 1L'L`@ d 'P< @'P丅0 'P 'Tb'P"?  81880220 2202#"  81 880220 2202` L&`"'L 2'P`'P'P   p'T\'L`d'Pg'T'LX  'P`'T`` 'PW'T 'PS'T`<@'P丅0 `'PD'T<`8'8H<( <ux(@4@o  t\耦  8.&    .``@.``(    @-`..``&@  `   @...`( 0`'@.`0"`` .``` 耠 @ ' ''''4n'(j t\؀  8.&   @ ذ .``@@.``(@   @-`.  .``&@  `   @.  ..`(0`'@.`0"`` ؆ .``` ؀ @ ' ''''@'(D'08>D',ض@B@'''@9'0((   0(&Բ.`0``" .``` Ȁ@ ''(',؆b@'''Ԇ',<8 ',丅0 D ','0` ԰@@b ''''8',Ԁ!?  808?802?20 2?202J?I?Ѐ   808?802?20 2?202?& ̀" _?  808?802?20 2?202? `?s(&'(  8/ & `  @+ȴ / & .`&@?` @ȇ/ "   ..`0(#@ȇ.`("`6ȅ.` 11< @|'@'('D',''H''04'(8'',''<''0D8D  8 ','0D<8 @',丅0 D','0|.@\'p<u8('tx`'l;` @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@. (0@ `'h'l@@2'p'h'p'p'h 't'p'h't'p|'h't `'h'p't~'4`,`'\'d'` 3 + x|'XdX+`@'P<u(\'T'L;  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@:  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@: @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@''';   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@''''   .```.` (          0( & IJ.`0&`` .``` @ '@)1  j1Lf'L 2'P`'P'P   U'T`'PdN'T'PX  H'T'''' ذ??(0&`?.`( ".` \d'@`'H'D''''  ??(0&`?؇.`( " .` X'4'<'8H<(D8@v',<u(@'04'(؁?` @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@܁:` @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@쨆@ @ ?`  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@'ƀ @:`  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ @ ': @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@''?`  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@''<  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@ '' ?`  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@'':  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@'' @'':`  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@'''@@''':  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@'' @ '''''<   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@ :`  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ @@'<   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@' @ '' :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@''€@ <   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@C '''''''''    .```.`(             0( & .`0#``  .``` @ ''''@&'Ԅ(   @?`0(&@`԰. 0  " .    Ȁ@  '( '( @ 'D'',' ''8','''Ԅ  '0D','H'0'8','<x'0?? `''','0'' v'|.@'p<ux('tx @ 'l'l5`-`5`-`  @`  ` > @  ='h@@2'p'h'p'p'h  .'t'h'p ('t|'p'h #'t  't'  'tdX* ` 'P<u8(\'T& 'L L@  , 4`,`4 'L 3 *+  & F`  & & `& 9;   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@B  @Bf  U & F`  & & `& 9 ;   @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ `B ?  @B?2 4  21< 0  2'P`'P'P    'T`d'P 'TX'P   'T  'T'  'T 'P'T? 'H<. D8n',<u(@'04'@'(''''8(1(܀ *(؀%(('ؖȘ  @?`0(&@`. 0  ".     ؆'(Ș  ?( 0&`?؇.`(  " .`  4?"   b@''''@g@'''@D'?" 趆@B@'''1'+` @ '@G@`@  '@'@@`'@8"'؁8 @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@''܁8@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@F`''8@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@F`'''''2c8  2^8 2YV " 萃@F '''@'2=􀠀8 2883 18 )8 #쀠8  耠 " 趆@B@''''@f '''`'2Ȁ2ȀȀ@ )1<􀠀Ͳ+`?"` 1< @ 'D'',' ''8','''԰ '0'D',''H''0'8',''<''0 '0' '0?? ''','0'''|  | 1<#䀦`` 'h'p'tu 'p't'p'tv'px't+`x 8'l'h h#@'h0+`` h`'hh'hX  X 1<}#䀦` `v   'Pq'TD 'Pk'T'Ph'TE'P`'T*3 + 8`'L    1 @ *"*3 6  + 1 @ 2 * 8 *@b*3 6  +  .@ * 2*  :'  $ <`!8<` 1<#䀣ز 8'','0'''8 ','0 ','08',4'0:  ش @(0&@؇.( " . '(''''''''    '԰& '''Բ  ?(0&`?؇.`( & .` 2   '@ '2 8  @'g ''''  ?(0&`?؇.`( '@ .` 2   ''䀠 '2& * 2  ܀@ @ @̄@ ''''f@'''ܲ  ?(0&`?؇.`( "@ .` 2   '''䀠'2422.2܀8 2(2؀ $2 @@ @@''''ض@ g@''''Ȅ 'ȵ2  ?(0&`?؇.`( # .` @ Ȅ'Ȅ'# (& &@|"'$| 1<#䀦  x`=x ?`t'$x+@x  +@  @ 3@``'3`Z'$ V'$X"R'$X 1<M#䀧`H  ``T' `7  '$5'ɀ'+% +*3@ 2`6 6 `` *   2@  `'3 *'$ '$< "'$<  1<#䀦` 44''$` 4 8 '$'`sB8/   `  @*/ ؄& .`&@?` @؇/ "   ..`0(#@؇.`("`؅.` 4r}؄ r 8.     @ ش .``@@.``(@   @-`.   .``&@  `   @.    ..`(0`'@.`0"`` ؆ .``` ؀ @ ' '    0(& .`0``" .``` '$8 '$ P'$5 'p't '$?$ 'l 'l$@82`l'l80l?'l20 l'l20l'll   'l$ ; /@?@@ '$l $(*'h'$ h *@'h 't'p F'$5 'P 'T '$?$ 'L 'L$86L'L80L?'L20 L'L20L'LL   $('L.@ 7  '$L  )x  'Tt'P '$5 ',`'0 '$?$ '( '($83(?'(80('(20 ('(20('((  $ (('('$''''Ԅ s   8/ & `  @+ȴ / & .`&@?` @ȇ/ "   ..`0(#@ȇ.`("`ȅ.` 1< '0', 1 ) x'L'T'P''''̲ Ȱ??(0&`?ȇ.`( " .` x',|'('0''''в Ȱ??(0&`?ȇ.`( " .` X'('0',X + 3 *@ 3 *'h'lX'p't<`=ذ    .```.`(           0(& .`0"`` ؆ .``` ؀@ 'ش   `?` 0(&@`. 0  " .    'h4<'l8't*'p<=ذ    .```.`(           0(& .`0"`` ؆ .``` ؀@ 'ش   `?`0(&@`. 0  " .    4<'L8'T'P00`''0 0'x`   x` X'$ `? `?2H'$ ?`A'$ >'$ 8'$?5'$ .'$?+'$x #'$? '$x@ @?'$ '$ '$? '$@ ?'$ '$'$$Q1< !U   ` @`?x`  ` @`?21<-' 00g'`'\ 0gg0   \` _'$`  `?\` `?2M'$ `?F'$ C'$ ='$?:'$` 3'$?0'$\@  )'$?&'$\@ ?'$ '$   '$?'$?2 '$@ ('$'$ '$$1< !V\'   `?g   `?1<`' 'h'p't' ?'P'Ty'?'''̄  '','0l' 'h'p'tc' 1)\) `?'P'TS'?? ''''','0F'h`7`@'h>?'h 'p't4' `'h+'t  'P'T?"' 'T?'?? `''','0'' '??'''̄'Ԅ '0'L?1)1?@#` 0``0@'D'''''@ '0 0'8  @'''䀢@'4@  @2 4@ '$4  `?@`  `?2u'$ ?Dn'$ k'$88D `'$?]'$4@  8 T'$?Q'$4@ 8?`G'$ D'$@8쀠  耠 8 `$'$?!'$882'$882'$܀8 82'$؀ 8?`'$ '$'$$`11< !W)@   `?`4   `?`1<`'1<#0  ~<u؇($v$r&t`"'lt` 一쀠ll'lh `'0"#h  hh 'hp`  h 'hp h`'hhl0 'h'lh2`'hl0p t t  't` t 'tp 'tt  'l'h?'l'h 'l F'll h .@ 6'h'0"h  ph``'hp  h 'h  h`'hh 'lA'hh'l6`'h9'h%'l 'h'0h   p6`  'hp  'h 'hh6`'h' 'h 'l'hh@ 'h'l0i?h*@l (. p (.`U"T"'LT 一 Lc`}'L '0"&@ @ @ AP  @ A  P @ A@ )1 1L`'L)1 1L0P T` T`  'T` T 'TP 'TT`'''L  'L??` 'L ))1@ 1L `8K'L` @ )ဠ1@  '0"&    AP   A  P  A  :'L'L1 )18'('L '0  P1 L @P2 1  @`L F 1 ` '''L  ''L07?L) 'P(.  (*`#"#0 "'(0  一`瀦`('(Ȱ`'0"? $8`2и̴Զ ƀF#,`# !и̴Զ ƀF, и̴Զ ƀF'''' (Ȱ   0(&ԇ.`0``" .``` '(ȴ   @?`0(&@`ԇ. 0  " .    (_0, 0 0  '0 0 '0,` '00 '(''' 'Ȇ?'(''''` +'(  t'(  8(. "@   @ ȴ .``@@.``(@   @-`.   .``&@  `   @ԅ.    ..`(0`'@ԇ.`0"`` Ȇ .``` Ȁ @ `''0"? $8`2и̴Զ ƀF#,# !и̴Զ ƀF, Ը̲ж F@'''' p'('(    0(& ԇ.`0``T" .``` ]''(ЄԄ@ '''''0"1 *0(`@,`  `@@ ,(`ƀ@''''ȅ0'''(''' ' 1#'('05?1 (*"`е."` 2`@,.@.+"@ H0 . @@ 6`?          2 @. @@H&`? 2@ *@*@ 2   㿘` "<  ( ` h ` `??"  "29?  &@4 # ( 24   "( \  !! ``  < "  ?\  !! ` ?㿘 h@ <g<ga`x@"   d@ڒ@ t,`@  <g<ga`@!  $&+`@㿘ϔ  ??# ?*  *@2@ 2@  a  .<g<gb(@!Ŗ?."@"㿘 h@  <g<gbhx@"" .`  `   @<g<gbh@! YW z        *@26  z * @ ܘ   ?" " & $&  z  6 z " z z?  +  ܔܘ?"" Z 㿐 h 2 <g("0r  M . ? ! pc ? * * 2` 2 @ ? @ @ @*`* @ 2 2`   0<g<gbД@!8 0 !?# #? ** 2` 2  T@Ő&@  @ @*`, 4`2`  T@&@ T@@ "@& z "  h 2 h ܀   h  ,  @  `*  @ ? *  @' " K?# ?* *@ 2 @2@ ?@ @?@0<g *  *` 2  2  ?<g * *` 2 2 @ ? \?@( <g@   \?@ <g<gbД(@ ˘ @?#/<g-<g'?@` $8` @( @2  Дh@ $   2`*     2`*  4  *`*  2 2  * * 2` 2 %     @82  l   ( " lE l  @&   ( 3  @2   `( " !     @Q` ~v @δ . !.  c #㿐?' h2 <g#  ΐ ,? !p` ?`   ( (+ *@  23`@  00@@0 @"` "\  2`\@@ !! `0`?# ?* * @ 2 @2@ @ ?` @ @*`* @ 2 2` @*??# 1?*+   2`3   T@&@ , {#?  * 2` "1h` @ @*`* @ 22`  T@&@z` 2h܀  h  , @ `R* @ ? 9<`*  $ `'  * `m`?4` ?*`@  `` @ " ??2c ? **` 2 2 `?2?  ?( `23?# ? * + @23 @ ?@ * @?   2  ` ?# ?*  + @2@ 3 @  2  ` @><`T $"@`2`@7 `$T" * 4`* @  ``  " ??2c ? **` 2 2 `?1?  @?'` 2@2?# ? * + @23 @ ?@ *@?   2  ?# ?*  + @2@ 3 @  2   âh  ?# :  4?  * 2` h   :'z  ܀   , @ `* @ ? &?*  T$'@o2``$T" * @ U  @   C?  ( ??` 23 ??#  ** @22@ ?@ * @ @  2  `@ ?# ?*  *@2@ 2@  2  `@ @ <g<gcȖ@]    `  $;  @  * " T@`?c ?+  *2@ @ 3 @ @?8  @*` @* 2 @  2` $<g  @*` @* 2 @  2` <g  *` *  2 2  \@? <g<gc@n<`$ ` @ (@R <g<hc(@s`Z V `̘     %&T`    2 `$:` `@+@!2  &`  T@* ?# 2`*  ?" 2`*  5 ` ? **2 @ @2@ "@ @ @ *`+  3` 2` %`   @2   `( "      @` "`{ `?c ? **` 2 2  <g<hcH@W~  '<g<hc@G `2`"z`$@s ֒   @U &  ( b "  ?c * 2 ? * 2` 5   @.2 ` ~  ( "` ;` ? ? + *2 @ @3 @  @ @ *`* 3` 2` %` l  @  ~Ւ  (   ,!,f # '?'!,[ #  p?  @? @*`(02` 㿘 "    @  2 @㿘     2  ݒ   㿈    .  ' ! p' h d @>? 0'쀢'?#7?;?G  z "  h 2 h ܀   h  ,  @  `*  @ ? ײ*  ! @ "+ p$ ` <h<h`@ @ +<h)<h`$<  -  ` @@ ` p   @ *` @+ * ( 0 @2`3`   2 $"@ T:  ,@ 2  p<h<h@Җ p  @ *` @+ * ( 0 @2`3`   2 $"@o T:  ,@ 2  \<h<h@`@ \ @5?#)?5<h-<h p` * *  @* 3` (2@ 3  @  2@ "@$@< T:   *@@ 2  \p@v \`@* p @<  * 2`  <h<ha@]' h ? # ? ** @2@ 2@ <h<h` @=!. Ӓ #    < $x @ 0(*   ?㿈?# @ `*`2 @  <h;"8<h6"X ?`<h-"p `$`h&`  <h!"`?`h pc?   ( (*`+   23`  00<h"  ??# *  ( @ @2 ``@ 3 `h0+`@ @<h#\#`#dК@`?P  `h    ? @7<h@    @  `<h 8@(  "B> 2; T  ?:@   @ C "?  ,`" `"?|ѐ ? 4` @͔  ,   |,  T`D@*   ? $#`  * 2` $       @  @ > `D& T?F#(@ 2@  ?  B > |qZ?`  **3  *`3`@  2   T ``  &  T2 T` + 3` B> ` `,:  4      * $  |,``,:  4  8  `    + ,: `@C+ 3`@; ??`<`@  08` `( 0 `T  ` 'P   <hX#h?h` ?"<   <h<hc@ q? *`*h2 "`$\  !! `2 `$"* `4"`$  ,P <ĖE?c<xc :?x#@ "@   '?"`  4`  `< t"'l7;l@ ”  'p "tԀ@8`   `` @`?`2p `@`$` D@ @H` $@ @ p  @ 0V #Bp~V p  @ 0I #2`p `p  @pp`  v< p` 2 p` { "u?t``$ D@ @$@$@` pp  z "W?V  @ pz_ ( pzp $Ag`$@&@p-x" p  z    @xx  @`  uѐ @` " `"?z ?` ` $ <x @ @` `u @`"?zp ?`,4$,`$@<\?4@P$8$4:K㿘` @  !  `? 㿘 " `* (@ \  !! `  " * `6 "㿐@?# ? ** @2@ 2@ "F  h x 5'􀦠`   "u- `  `)?y %?     ` u   y   @ה ` ?"` 㿘&@?# ? ** @22@ @  2  h  yΰ? & 㿘   2 㿐ǖ #   h` 2 @ .` $@ ] 2 h`` 2 @ 􀢠yl 㿐 #   h` 2 @ .` $@  2 h`` 2 @ 􀢠y? 㿐m #   h` 2 @ .` $@  2 h`` 2 @ 􀢠y 㿘`< "( @@   @   Ф Ԣ ؒV@b@@  @@ @ ?㿘T    ?# ?*  *@2@ 2 @ x  . <h<hc@K?. | "@"㿘 h@  <i<i` @ x   |2  h " hu  h .`  `  | @"h<i<i`@h [Y(2  2  |  |   *@2(2 6  x |* @    ?" " & |$&  x  6 x " xx; x?  +  ܘ?"" J 㿐  h<i 0 `<i 0V $`<i 0値2 <i!0ހ   ,`! p?# ? ** 2` 2 ( X<i<ia8H@r@>@ # < " @*@  `?'  $<  @( @ <i<iap@`% `  2`*     * 2` 2  2`*  ?  * 2` 2  @>2 w  ( "wK? ? + *2 @ @3 @ ` @ @ *`* 3` 2` %l  @ v  ( w!  @2  vԒ `( " w     @?`  rd  ,0!,V #㿐 U$ ǐ? 2h?& & h `   ,``0 !`p<@? & A ?# ? **2`  2`h@Q `h _ " `h   * 2`  "   @  ` *`2* 2@  @$`h `h ڐX  2  ? # @ `*`2 @"`h  `h  ?# :$  " `h   * 2` 2 `h, * # `h  ?# :  " `h   * 2` 2 `h * ː * ! #,`?&s `@ `X$@ ' C?  ( ??` 23 ??#  ** @22@ ?@ * @ @  2  `@ ?# ?*  *@2@ 2@  2  `@ 8<$  @ (@ <i<ia@9< @2 `  ut `( "` u `    @ߔ` "`Xq `X ?# @ `*`2 @<i<iؖa@P#`X@a@ ?# ? ** 2` 2 ( <i<ia@.! #,`U < 2`*  ? 2`*  @  5   2`*    * 2` 5   @%2 t  ( "u2? ? + *2 @ @3 @  @ @ *`* 3` 2` %`l  @  t̒  (  u ,` 6 $6 "& h`6  6 &` ""($ <(@ @ 6 (d6 (& <& & @!<\"@  & 4&!& 8& 0<@( & ܐ &  & & . . & & & & d  & <" & `""!,` #& p? @? @*`(02` 㿘   }w .  `! h  p, 0?#-<i+<i1  *   X  2``  * 2` Hbh@, h ݐ ?# ? ** @2@ 2@ <i<ibH@!.  #㿘@2㿘 (  $ "<\"@ &  ` & S h   2  2 @ @`& ,@P$㿘! ! &!*!2㿘 h ` "!|ڐ !G!@ " ` ?  h&!&! sG 2 ` h<i<ib@? 2 h " ho7 h @`$w/ ` @ `s `( `s`s "<  !!  㿘 h ! * * ` 2`<i<i c @80/` 4&* @6&@ &&" @ 6 &@ ?@>@  &&& >@ @ <i?>@ @  & &&& <i c @ӔH㿈 4`* ?c ? ** 2` 2$ ! `h s`  ?$* @  **@ 3 @ 2sV@  2`h0 㿘`h.` `2 @   ?# ?*  , @2`h@ 4  @ r_`  0P?倦'} ?# ?*  *@2@ 2@`"a$ `, @栄?, 2`h T@``h?`p`? + *@ 2@ 3 @   Ē`h r`   /  "rؐ?c ?*` ,  2 4  $`@$`$a<\"@@`h$`8$`@  ` `怢 "`@0 㿘`h  \2` 'H  H  @HH`  m H`  H` r ݰ . $@ ?# %?* *@ 2 @2@ '?H q @ @*`* @2 2` g H?倦%H  rNH?`$# ?  ** @2@ 2 @ `"a` H $, @ *  *` 2  2 ֠?`H  2HH m rᤒ q8?c ?+  * 2` 3 ?  H  "yqu *`,   2 2` %H `@2 `hqe `( "`hq`h "`   `  `怢    @ŔHH` <\l <\"@`@$`8`@ $`@H$a$` q㿀є? #&  @?!&  &!?&< ` @#\ך?2 h  㿐 @̖ J'􀦠-< "  2( @($ ha "`p  `̀6@  ' qDqB  h p `̀     @:` l_    ?q$?& 㿘  ( h h!@  h? p#@/? * * 2` 2 @  +?<i<i cX@ h0 X@V h@ <i<icX@ z0!  t6@*  d @ <i<icX@ i0@ ha@$,   @**` @ 2 @ `2`  4  ` p 2  h<i<i hcX @ A0]` $?   * 2` 6 "   2`*  6 &  @ `2 *`@6 (   2`*  6 $  @**` @ 2 @ 2` & ,  @**` @ 2 @ 2` & 0 @**` @ 2 @ 2` & 8  @**` @ 2 @ 2` & 4  @*  @*` @2 2`  &  pJ0& < ?#? *`* < 2!0 2 & @`#!0& D d *`*  !2 2 *@ & &! < **  2` 2 &  p **  2` 2 & t?. u6 .  h *`*  2 " 2 @ @ &  l @ @*`* @2 2` & &  l @ @*`* @22`  &!  l`?& ,!& & &!<i<i hcX@ ] "< @ @  ( (? @2 2`  6 *   @  "@ `" o ? .& d "<  @ <!#& d@(< & d@<"& d@<!& d@<!$& d@2  ܀ &    & &  ܀     a& &  ܀ "     b& &  ܀    `$& & h㿐 `  h!@  h? p#@+? * * 2` 2 @  '? <j<i`@ hR? X@ h <j<i`!  t2 d*   ' h<j<i`@ ?01 h $?@L`X@a,   @**` @ 2 @ `2`  4  ` o  ' <j h<i`@ r? h< " @ `$2 *`@ 2 &  2`*  0 ( @ `2 *`@0 $  2`*  0 , @**` @ 2 @ 2`  0 @**` @ 2 @ 2`  8 @**` @ 2 @ 2`  4 @**` @ 2 @ 2`  @ @**` @ 2 @ 2`  @**` @ 2 @ 2` d @**` @ 2 @ 2`  ܔ @**` @ 2 @ 2`  @**` @ 2 @ 2` p (t (u *  *@ 2 2 @ @ h " 2!  @ @*`* @2 2` l "< @ @( *?2*   c *`*   (   @  "@ `  @ `m `( `m̐ `  @` i"    2  !<jhF ( a? m㿘 㿘 㿘@?$, ` ܓ22`  ` @2 \22`  ` @" \"2   &@"@\   !!`"`@ "` xV?#@   J? 2D&@$"7 ``  ܐ ` ܐ ? & `&   ܐ$`  ܐ ; & `&   ܐ!`   ܐ > & `&   ܐ"`  ܐ = & &  27㿘""D""D? " ""w ?;  ?&D;   ? 2? ܔ 0 0@" \" !! `"}?  &@" h\  !! `"l? h "  2d? ܀ ? &    ? &  ! >&  " =&  $ ;6& ; ::? &05 &@" h\  !! `2 h$? "D "D?;  & ?& <\ ?<\"@ & 8u P'`h@; `, ؀  Ö,` &` 2- $ 4 `, `,, `,    @F  ?$*  2  n " g^  "j  $ ;?#8,       @`? <j P D .` "`k``.`A'   * 2` - ʦ " k `,*    7 ?$*   &  2`,- "  `, z .` `k`.` 㿐`D(`@$?0  ?@# ?*  *2` 2 k  h4 ?| 㿘?'`3&T`$ /-`h`, '   "  $? ?'  $   2 " ka 4   "Ұ `, 2 $?'Ȱ ?$c 2`*  4  `ܒ `*$`,$`/<j $<j ` 2 ? 'k%      @`?  ? 'k ?# ? ** @ 2 2@@   -  * 2` 2 ?    ?2*2`  V?# @?*` @+` 2   *`23`@  "@  2`*   2 `   `*`@ @4  $, , @ <\"@`$`4`* $`܀ $`8<a0  "a0$`D @V2 &j'  ( "&jc& '   * 2` 㿘` `$@5 ?#<j p  (?2 "$  @  `2* *`2 @   * 2 4   * 2` `@@ Ѡ?㿈?' <m !$ d`4 "+`@`D ' $ ?`4 $P ?# ?*  *@2@ 2@ " h!` *`<a0  "a0& D@2  h i `( " hi  h "       @` e  쀢 "i 㿈?'  4 &4 "$ d`@`D5 ' ?# ?*  *@2<@ !02@ " #!0& D "<   0<!$ d ha 41   h!`*'  <!$ d ha   <!$$ d ha    <ܐ h!` *`< 2 4 * J  @2  hhՒ `( " hi  h "       @8` d] Y쀢 "'i"'  $ ?`4 $Ր㿈V $`?ဢ %'?'  <  h$ d` $ ,$ @   2  $ ?4 $`?# `$*`* ?'  + 2 2 # `<j`   `@ *`@3`3` h!`? +`  <j  @ * `+`3 2*` @   2'  h?  2`*  *22 *  h!`* 4 $` @A `h `( `hN`"phzp`8 # 4 " "$4 " 2`@^`@`Dۖ ]' ?# ?*  *@2@ 2@ " h!` *`<a0  "a0& D@2  h gĒ `( " hg  h "       @'` " $cL  $ ܐ  * 6 $& <쀢 ""'h' 4 $ 㿐 ,   h   2 `$ <j h<j`@- ?# @?* +` @ @2 3`@ + 2 @   @?  * *` 2 2 <j @v 2  <j @v "  <j<j h`@T`  @ 2 `*  *`2@  ,@ C`" ``$`   `" `g `4   2`$%` <j   ?  **` 2 2 ` gh   * 2`  , À`` gU 㿐`@`DӖ ?u'`?c ?*` * 2 2  b?8 ]?<0`"0 `Q& D  @Ԟ2  hf `( " hf  h "       @ ` "T $b. T $<j<j ha@80  $0$ D`4 $$ ,ߐ $<\?6 $@& 4& 8$ 8  *`& ΐ f㿐`@`DM ?p'`?@# ?*  *@2@ 2 @ ]?T $   h<j<ja@P@  4 $ K<a0  "a0$`D@G2 `h f `( "`hfS `h "`  `    @{` <\a <\"@`$`8`* $`܀ $`4X $ ?`4 $P`8$ 8  fN㿈?' '(  (<!b`h$`d4`" ?  N  `;`@ `;N 2``;   2$`$`?`4`$ Ґ``h  ` N*`h ` ?N * @ ey ( e"`e` $`,Ґ`@`DO '`?# ?*  *@2@ 2@ " h!` *`<a0  "a0& D@g2  h e8 `( " hes  h "       @䛔` ` 쀢 "eE'㿈 !< "# 2V $? @$@?D ' ?# ?*  *@2@ 2@ " h!`-  "  $ ( 0     < *`<a0  "a0&`D@ў2 `h d `( "`hdݐ `h "`  `    @` `* 쀢 " $d $<\ 6 $@ & 8ސ `&  㿀`@`D']'`?'쀢  K'?c ?*` * 2 2  :`@ =D '䀦`2 "d' "<  29䀦`?' `?'  $좒 ?`$  2`*  ? **2`  2  `?ဦ` '쀦V$ @퀤`䀢 2 7<D@쀢 '7<0<\ &0&D@  `$ 8L ?# ?*  *@2@ 2@ "h!` *`0``&0 & D`$?6`$@` &`8" @*@ & 8& ܀& 4`G?`$ @ ? @ +` @ +  2 ` *`23`@  ` @2  $c `( " $cƐ $ ?`6 $`" $`$`?`6`$ېܐ * 6$&ΐ  @2  hcY `( " hc  h "       @⼔` ^   @_2 hc1 `( "hcl h "      @└` "'^ '쀤`c耢 "c{䀢 cu㿘 'P'T )'X!?` p6!: * 2`   * 2 2: l  @  bْ  (  c . <"h@tbP @2  p?<c * 2`   0 !<j]!x!<j]!"h <j p?<c * 2`  P<j! `& 㿘 'P'T )'X!?` p6!: * 2`   * 2 2: l  @  bh  (  b . <"h@sP `2.  !<j` !x]#& ;㿘#<bhP'P'T'X@sؐ !<j]!*㿘 2 `!?c * 2` p 2: l  @I2  `b  ( " `bV `     t, @  by& t t@,` ,   bk ,  ,   b` ,  l bW㿐 <j2    &b@qD '*@ '<jb @q+ <j ?'b(@q! '<j􀢠"J <j @qb0 x<j@q b8 <j '@qb@ <j 'ʐ"Hbp@p <j 'bx@p 1<j􀢠<jJ <j<j" @pےb <j ? '@pВbȀ <j ? '@pŒb؀ <j ?ϐ @'"c@p <jc@p <j 'c @p <j 'c(@p <j ?'c0@p <jc8@p <j ?r'cH@p <j`<jJ@  <j9#P@q 6J@ X<j;#c@pg <k`<jJ@  <j#@q 6J@ <<j#`@pK <k`<kJ@  <k Ͱ 0.@qf &@J@ <k @ 0!``@p+ <k`p@p% <k`x@p <k`@p <k "@p ْ = 㿈`L?# ? ** 2` 2 <k  `&  !  <k!<k!H`6  * 2` * 2`4  * 2` <k!b!<\%`:`D?# ?* *@ 2 @2@ ?!<\`@ @* @*` @ 2 2` "@ <k>!`:?c 2*  `6c @ * 2`  *2 6`:6`6`4? 2`*    2`*  6`4"@  **` 2 2 &`, l`@<2  `  `( " `I  .  <k D<k h<k T"0#d Xbx#\#` q덐㿘 p?  *`*?  2  h2  @  ?\   -<k7<k5<k3<k d@{ 2 t- $ *  *` 2  2   T * *  *` 2  2   * *  *` 2  2   \ c   h` @   㿐  -'4 77^  c $&  2 6  ". hr. `!^2d @z* *` @z_В 2  $6  0!. ђ #<kj#P?& p`8c  ;* 2` S & $  0!<k#xY6 !. 歒 # L _{H `L? * *` 2 2 .?`` @*` @ * 2 @  2` ?!<k#Y 2 p`d @ @ *`* @ 2 2` ?!<k#Yz p? c ?*` * 2 2   *@. d>& h@29`L]P5`   <l) @ " _ 5`] ,` @ym@zO_# 2 $<l  p& p`8c <l q 0j6 `L?# ?* *@ 2 @2@ ?`X * 2` &!`T @ @*`* @2 2`  &!<l Ȓ F 0?6   &!&!`\?#? ** 2` 2 &!``$ **2`  2 &!`d @ @ *`+  3`2`  &! `( `& D@x & H& $` ?#?  ** 2` 2 & T`$  ** 2` 2 & P`( @*  @ *`3  2`  !& X@xː @x& L4`& \& d`& l 6!`P  * 2` 6! "`R 6!?# @ `*`2 @6!`:?c  2`* 2 8 6!  02` d&!8  2   $;#S@&! 26 !<k #x   26 !<l Xr5`6  D <l!6  T* <l|!Xu6  P@ <lt!m6  X@ (`<lk!d6 ?`c ?  +`*`( ( 23    00" @x0? d & h@x*?,:  & t<l>!76  @) ]ԑ5` t,`"@  t `2` ,%<l t, @  ]& t t;ے6 @ܠ 5  |  , t, @  ]& t t;<l"86    ܐ  " " " "  6 x6 z& `!. 䌒 #<!& 6   & , 6 @ , t,`@ `]F@& t t; <l];<l"` 0㿘<\"@?c ? **` 2 2 &`0 l `@ў2 . \ `( ". \ސ. 㿘 2&.  p? : * 2` ` @ ` 2 *`@3 :<\"@? **` 2 2 # , . 㿈! !77'쀢 S?& 6!6!@  @F p`5?:a?#! ;? 2`*  6:<\b@ **` 2 2 &, l `@V  \' `(  \c . ` :?c 2`*  6!& d X 1  p?`# * *? @2! @ 2 @  h  Y 2 h   ` h `@wT` \@wO` p; #S''`?##? **  2` 2 "' p'` *+  @ 2@ 3 @ " '` +  *@ 2@ 3 @ %?' p@  **@ 3 @ 2@ &'̒ 'Ѐ 'D;@ @  ?㿐  @     q 2`$ ?u`[ѐ㿐  h     @    K 2`$ - +  J    J 2  D;@  @  2?5`[㿘 h`$ 'H2`H`  V   ` `V `HH@   A `@& 29 ?& h#` * + ?  @@23`  @ " 3 @ & @<H [P @ Z ( Zz 0! h "  H H `   @HH` HV? H [㿘 h    ,2`  @u]? F ?,#`? @ @ *`* 2 2` 1 h X "$   $   "$ZԐ  @ "`& @  Z֐ " $@@    ¤ 㿘?# @-?*` @* 2 2`    %?  h Z  @ @*`* @2 2` ` Z~ ' h<l<lb & @! Y (  Z.~  2z Nv   ,2`  2`@t?, ] `$,` Up? @ @ *`* 2 2` B h X "$`   &` ` "$Z.  @ "`& @ ``Z!` @ Y `(  Yΐ " $@ E &`$ 9[㿘?# +?* *@ 2 @2@  #?h  h Y  @ @*`* @2 2` R YN ' h<l<lb 9& @W: Y( ( 3 Yd/  2+ '   ,2` @s?"@s0 & 6@t$,  Ȗ @㿘 خ ؀  b ?# ?*  , @2@  h4 @ Yl  ؀ J YBF  h<l<l bДǘ & (5  4 @t0 , @s"@t%@rʐ & @6@t $,`@t@*`@v 㿐 "<  @ @(@ #ު䢐 Т 7'<\ "  2   < <<`܀ "H/``"`܁  "   €"` 2  ީ!   h 2``  52 h h`  ,?& `:   @ h  $"@@vJ  @~0 X (  X= @Xi@ & 4 & 8X㿘<_|"x`?  <" <㿘  < ?<l Ð"0  & < @ <l #@@㿘 ? /<"€   "6 $㿘 ? /    € 㿐6@ F6<l @glc( "@ !<l =@f '*@ '@f#0 <l`"+ J@  @h 6@@f̒c8 2 `" J@   @g 6J@   @g/c( 2ǒ = 㿘` " h ` <  (`@?‎`"  "29?  &@<  ( 2<   "( \  !! ``  < "  ?\  !! ` ?㿘  23??/-6 * p :@ `<\*`"H@``` 2``ep 2 `  ?󀢀    ? 㿘Ґ @ <l#@< H?  /<"€  h<l텐#p&  "6 " 6 &6 ( 2& , 2& dV  6 $ƀ   <8  `4@ `` "`4 $ 6 $`4@ 2``0㿘   _p . <`!"$'㠘 & & <. & $8  "<l & , & ( 0!. ˒ #0<l#X6  0!. ݽ # X'#$ ?'''''̀ 'D;@ @z  ?<\"@?$"4"<"8"0N"@ 22$"d2"2&2(`D",:` <\(H :? ` 2 3? "! \ !2&!2( "?%t* * < @("d",2" a@2" "2"㿘9<#<# <  h l" < <' &<@ <Đ`"""  ?<Ā  22?  <<<h"l<"  㿘<l#<c< "Ѐ?㿘<l#<c<ː# ?€㿘<  `2?("  0` 3⸃(`  @(@{'#?㿘@ 2  ( 66@(? (<&` &`$& (`  (` 2 < &`  6 `   <#  <#&` < `<`"@P 2 @"@""` @`2`㿘 (( (<"2  <# "  ?6 p/ 2 (`  @ (@zž  2?x<l`c@g&  D;@ @xx`<lc@fn㿘   "? : 2 8?􀢠€4  D;@ @x:P 㿘   :}  2 8 €mӐ:6    "@" " 㿘 ?   ( ` "  "  `D2  `@@u  "   `<? @  h'?"&`P7w 㿘  <"B6 $<8 `4 @"`` "`4 $ 6 $`4@ 2`` ? `@`D? J?Ѐ`  +  *     ;  <\* bH ` `` 2`  `+  h<`˔ 2  ?"$ <"&`P֐ 㿘  ```G?   "`$ `(<m`  ƀ 4  `B > `$<ma ƀ %  `B > `(? ?` "@` ?` `ƀ  &   `B > ` `2@  ? <8 4 `"4<4*   "@8    4 1!> !ج  :& , ,   @lR 0-@m    "ƀ &   `B  >   ?0`: <\(H ` 2 \ 22 (2 (2 &㿘     @t`? 㿐   ` '8ޒ o?jf ,`' $ `` `?@  '0L,  $ ;'4 "6 "0/D;@  @*@v "? <  :@ C>@ 87 㿘  ` 4  ,?    ?&?;  @B B; ??㿘<"8"  4 " ` ?@a; / 2 (&&@ 㿐'L 'Lؔ 0@p\E/  '@o D D@nA<@ & @ 6 o"am<!L &  6 `o @o"a$ 6 6 L㿘0//㿐`'H'H $@pH (   " H < & @6 ѐ0H<m!h@ 㿘Ɛ *?`&` 2`0 "`  "   `@ 24`@:` <\(H  ` 2 "  2 x2 㿘  ` 2d?x 0["HӒ@SR ̐"h@LK 8);6 @A <m@;"7 @4 2<m@.@+ ) @& o " 4" &D  @u!&@   2  x@@  >$  2 ? @B 6; ??㿘  X` 2`ް?<m"@<m"UӰ?`ex" `,@ N   8 ? $ex@@ 2?@ ͐@@8@"?@ Ò@@"? : ` !? " `$``," @   ex  @@w  @s `:e`ex   8  @d@b@`x@\@Z U?@U P?@P@ 2 `  C?` "@@ @2 @x  2?@1<@0@-@@*@(@<"b2 :`@@"2 * @<b(`@` @u`$ $` @@` @ 㿘 Őh}  `? :# ?: <\* bH `Q`` 2``J"ep & "ep 9- 4( ex .`*` "` `0 2 ` `2`0?et*` `*`@     &㿘 5u 2;?   "< 0@ <m"@ <m"耣  @a 0$@&*  D;@ @sd5 㿘 M < `? 㿘 ?2`#V @`2T?`D `@K 0"K??K?Ѐ` A +` * @ @: : <\* bH  ``` 2`` et` `@+``@"?  *@  h Ɣ  <"&`P֐ ?㿈 ?`#3   o `)?'<m`  `ƀ \ `B `> = <\* bH "L`2Et; `@,``@"+  & -` @iڐ 0-@h   @  "@ ƀ @` ``B > t``@ €` eefgHf fgHgHgHgHgHgHgHgHf0fXfxffff@ffgHfgHggfgHg g0gHfhhhhhhhhhhh\ !  ?!@kH<b!* 'H 'R "8 !!"H` D;@  @r @&"@8`" D;@ :@k@&"D;@ : <@p@q > B>㿐<<!8<` *`* '5 "@ 8  <󀦠a4;D@ : .@` 2Da4  ?D;@  @q > B>㿘<!8<4@kG*`㿀<"<`%<"< `   '* *`!< "(@(*#< +`b@0 ; <m#\#`#d#h#lc: 2 ; @_}3` 0<<a@ !  '<*  @ D  x <m#\ c#` $#d (#h ,#l 0#p 4#t 8#x <#| @# D# H# L# P;  D T # X@  \@ ##  `# d# h# l# p# t###@_*<n`p *  @_D Ƞa@@gD d<\b@"<"<n`x@_㿘<!D<#<nТ`a@ d@g+@h  d d@g# d@h@^@;!<<n# #\ؑ* #`̄#Ș Ж" `;h#d@^ɐ# +`#\ؑ2 ȅ0 #d<nԐ@#`a02 2 3 @^3` 㿘<!@['@j㿘<n<Sa@^㿘 "K %x`"G <@:C `   `<nې!9 @Y@V 1 @P  <nȐ!@H$ @C@ @;  <nⲐ"@2 @.@+ " @&o㿘 @  J` /`.  `@/2J㿘>  <\* bH `" ``2``  ex   P L㿘>  <\* bH `" ``2``  ex   H D " " <<! %Ȁ@ @   `<  `8 "`"@""%   ?@ 3 * @ * "@3 *  )" `h>  <\* bH ```2``<nа b(@g `a– ee \ n  ` . \ .  2 ..  2  .@< `"2```x<n `ba`` a#\a #`a #da#ha#la#pa@]R#ta %<na, @]Ga  @<n@]>bex@9<#4 T X \ %0" 2 !@    2  2##`<n. #@#db*+ #\@]@<n@\cX@Ր <n*ch@\ɐ*<ncx@\ٺ<n*c@\אٯ* a\<na`ad@\ʒc@&@>  <\* bH  `2 Ű <%x"`!!p2``   . <#)  ! " @ 2 \ \ 6\d!d "!\  !! `! H }!؀?   2`@  :`" " 2`*  `   x-  `:` d<n#\# l#d#`#h #l #p #t #x #| # # # #### # ##%x "# T#"#!#%x "# (#%x "# ,#%x "# @###% #%  @ #### #!# P# (#@[㿈'L'P'T@'X8'L9@"@  'q'@  <o @f@@ 85+%M @  <o `@B@z,@ $p/\`@i" &P@ "@X "@[1<<"b2 @@Q"2 * <@*`@ ` T@ "@@*  @ L@ x       >  <\* bH  `2 2%xC `53<o<#@"1#\@ "-#\ @%x  #\''''> @     !2@  @(@   2 #\#`#d`@[㿈'L . ??>  <\* bH ```2``ex <#@@ ` $  * 2`   @:  /    <  8 q4;<o  -   r/  - w/  - x / p s// 0    | ?ϐ @-B `  ,#\#`@Z 0` 1p ,@  1&,@% ,@ & D8 " D;  @@l;& D4`2 4, @ , = B?L%- 㿘`!b<Ӑ L*` €Y'UEQѐMpIE?;'ʐ7@ϐ3@ -p)P2%3!@OEOp4 8L w?  :` <\(H"` 2`-`\d0ada ex" ` 4  2\2 \ !   㿘`  <Ӑ ԓ*` €ېTl ?㿐  , - 2 ~?? 4 # ` ' ,͒ l? ` @ ` , 0J " D;@  @j > B>1>  , $ @B  @ &  D;@  @jǔ< >,b 㿘 ? c2   ?ϐ 㿘  ۂ 㿘  {  㿘t 㿘<#|`"<m<#x` A 㿘<oa@X  $@&&@㿐    ,9  ?09+ 06';/,4,< x   Ŗ @D  @j5 > B>&Ҥ+ɒ 㿘  )?<`x   + ?"  D;@ @j `x   ?+     ?;   @B; ??`< !T t /<o-<o1<oT ` T  @WT @WبT  "    *5T  #*/T T   <o-! <o(!<o<o#"!"<o"T  <o<o" "0T   <o"8<o<o "H"X:@W"` <o"p@<o"  T #\@W@@@ @   2T  @ '& @&&@㿘<"       `<o"@<o" @W\@ @6`  ``@` '& @&&@㿘 2   ` H <"t Ò  "0 ","4& H㿘 H <bt& H"~㿈` 2 PN@` ` D <o "2 P<o#  P''` @㿘 h     ,   2 $@֔ " $ @ @* D 85 i @ @  % @`? @ D}`  @ "X $@` h ! Z` @ G 2 h `[ @  `Y a n@  `@{`  h X$  `` ^ y U`?D)  , z D 㿘 h ,`P  )&`P ?$Q) `  h| ?ww) 㿘 h @h& h@ `   H H."??  0 ("` ` @  H H." <4h   @   0( "` 㿘` @ ?`."   ?`."   @ @Q 2 㿘` @ ?`."   ?`."   @ @d 2 㿘` 㿘x 㿘Ŗ 㿘 㿘B 㿘Z 㿘 㿘v 㿐 n y u$!m.`.`.`&`6` .@.`.`6`6`&` .`<o @Rcc <o#<oJ#L   L L`@ ` L L`@ `` @d}  <o n.`J##L   L J@ ` L J@ ` @d[  <o n`.`J#(#(L   L J@ ` L J@ ` @d9  <o y>.`J#0#0L   L J@ ` L J@ ` L J@ ` JL " <o y.`+ J8:`@8` L J@ ` L J@ ` JL "  .`@Q> = <o. c@@Q( <o cP&`N  ,2 `"ް .cP@Q 1<o /cxN`"<oN  2 <o<o@Q#X <o.@c`@P <o o.@ch@P <o n.@@Pcp   a.@cx@Pݐ (<o &cN`"<oN  2 <o<o@Pڐ# <o.`c@PÐ <o r}.`@Pc ~  st.`c@P - "s N`" <oN  2 <o<o@P# _ <oc@P W<oc@P Q<oc@P K<o@Pc F J "H <oc@P} <oc@Pw <oc@Pq <oc@Pk 2/  @Q'J`2$ L g"6` m b 0 u  0 &`6`6`  @P [<o . 2 : G   C D/ ?7 2 ?,`%` /R/P!D:r4  P  !DP<oT#ט `<pP T<p׎ !D!D:R4   !D 2h  'L'Ը      I . `!Ғؒ 0 '̑, '?2 8' :  к 2 ?9. X|``d@ ",@@ג !<p$<pL `8J`8  `JK ``JK ``JK  ``JK "@`6<p@K n@F ]'ԦX @; TMX %2N MY /2J Oڀ yZ MZ @ C  E " <p @ؒH J x xL    JK   JK   JK   JK "@ @ `% n. X/ٸ "`@``d@ _  "@'Ԁ Oـ n``  X@& H@Ր & P@& T  P@& H@ɐ& P@& T P& D@ <pd  b"  <ph" <p& P %"``& $& @`@` P,  & L@@ P, Ԁ`? ?@" SБ2`> S& .  & h O쀢 <p @di  & h쀢 @d& hO<aؐ yۀܐ@? &  . Y L. Z. ]. ^6 f6 d. \6 bx Z`  L . Z<p& L x" Lx݀ u`  s r/݀`%. [`d r & ,ݐ` `r * <a<*  "P̒!. a #0<<pհ 0<pլ w h "(6 @d$6 !9t՚6  PՕ!`!Տ L <pՆ!"6 ?6 ̒!. & # X % P` H"  D*@  ?'''''Ȁ 'D;@ @b  ?㿘@  "  >㿘`<p=!A h ,.@  0<p!-1 <p(" <p"` $ ਰ ࠪ `଀&h`ְhw/ Ъ```wG``dې`h$ > 㿘 h   X& ,&    4 2  $ > `<p $ ` " h>W h  x4  8  %%`!1  : @Zg >7    >P *@ $@ZR@`  ,@& ,& $@J  `d" `   >  ?>?<p"Ԁ` ? ?<p "t߀`㿘 h  X 2  > <q  $  @@  $<pO#H  $@@Y=Ɛ `= ߔ$ $@Y ` @    !m 6 "6 $%`  h `b  6 $6 " `  @ ` L`!`!@ 6 ` J . ;2` ` @`!J `;2 h " I6 " hf6 &d& <6 (@q& @& L     ,@c& , ,@  h ]`n `y<p#p h y*`] h ]`y2 L` ,?@*@& ,L` <pҐ#& ,L` <p ɐ#ؒ@;`& 4& 8& 0@1`@`& @ h`f 26 & h d 26 (@` h ]`n2 " <q ӝ  h y*`] "<  @ & d<!$& d@(<"|& d@<"& d@<!& d@<!$& d@g_  <0<q_ `  6 $6 "& d& 8& 0& 4& & ,& <& @6 (6 &  1 ! ! -???( .  ;H;;H1; ; ;H1 ;" .*@   ڄ? 㿘ƒ 2 L  !2 " " C<qL `J`  NK @ ` NK @ ` @^   $N@ _2   !.@     ,.@ @  *<q  @Nt` 㿈 h   'L /` 'P`@X X' Ķ 2  $V  $@ *  @ "`<` xh ?C   @W>`   %@X$ `;   @ $@X  J@    `  B>`o    L !  `<q``  SL `  L ! 2 h`<q ` L@` h `^ n  2=` Z   @ ` `! h `[ @ `Y a n 2  ! `LP@  `  B>` ,: `49  `3 ;X 㿘   !5   $  0? J 2?  ( (㿘  ( @ (@* @ ( (*`  㿘hN`N N N N N  N .F (   (''''??'''耦'섆,8`  Ȱ@?`2`4((( (( (? 4h/  ((&㿘N !       `? `h `Z   !`2 "M"q *   L @/$@  "RE@/L@ `03@#P@`0,L  N $` G`0  C  >`0`0`H 2D A > `4  #,  `h :Z`  $@@V[:/  ߮ <qЧ 0 㿘h Z `    .@  !`2 "c" *  "E @N$@  "R#E@"M@"`0I@#P@`0B  f`0=  b  ]`04ɐ Ɛ Ð *(`  ` #` ``<qC `@W  ?   @H   4?H0?`4  >   h 9  $@@U9  ߬ <q   㿘`h Z `  T   !`2 ""C *  ` X @ ^%@#L#L@ 4#E@/`0!R@"4`h N@U`0@ ? #P"E@ΐ"R@ `0퀢@  F@Q`0L` `0 `  ` `0 ` ` `ͮ <q*ZϏ! `  )<q'<q`Lυ( `  &L~!0``6`"` 6`$`6`&`6`(ݐ`ڐ`  , 6`*,  6`* `  `̒ &`8  `  , " @ &`4  `  , " @ &`0  ` t, " @ m&`8&`,`$h`, ?    <q0 <q0 `, &`,`,`,  &`,`,  &`, !8 "  ` ` ":`, 26`,`,  &`,ǀ À`, &`,%`,<q!`HU``h&` Pq*@ ="6`"$6`$&6`&(6`(*6`*,&`,0&`08&`84q &`4`4 ސ#(  `h 8V`  $@@TW8+  ߸ <qΣ 0 㿘h Z    ` <q̉! 8'2@ ܒ?$  <q  !`2 ""@  *  "R %@ #L#Et`0|#P`0u  `0p  `  `0g`c-<q 2 ,   `. ?     <q! <q! @Fw  <qa<qa@F[  @FU  "  ``  #` @F?`  ` `@F3耤`  `YV S`4o `  @  h 7n  $@@So7C  ޺ <qͻ 760` ͐ " Ȑ <qͦ" 쀦͢"@耦㿘4#   @UI4 D;@ @[  2?㿘 ܰ P90g?㿐 ` @`@`  $,㿘*@   @[?2&. `@` 4`&㿘h `\  `h  !2  !2    ;   1"?   ?`."? h   :"<2"2*"d:ȄP"T"PX"\"X`"d"`h"l"h"p"t"x"|<l@ ""<2h pha@"@"D㿘<"`<q "x̾   "6 $㿘<"`<q "̮ lM㿘 D@#. D @~@#` "@C$@ 8㿘 D @  D ` @<q"u      D@S L`2@<qe"6 `<q`#<q#8<q#@V @`$&a\@ $&a`@  D`( ?&`( D@S@`4 `( '`@Q `L  ad@'<q.#Ho6 @QҒaf`L@QΔ `2 <q#_6   >B .   ! <@ !i,& $& & . a`   D`\ 0  D`\  0 + " * *& @S1 D`,#8  @ `   * " * $ `0#8  @ `   * " * $ `(?c $ `(` "`<&`@&`<&`H&`D`<*@ *`@ *`$ $`@*@ *`@ *`$ (`D*@ *`@ *`$ ,`H*@ *`@ *`$ 0a\@S9$ 4   $ 8@C`( <  $  @&  <!\$  &  `4*` `(* `:@'7:"`#p' ` /`#p n'W ` 7  @R 2`(<q;#_   !2 < 8@}  2`(<q%#I 2  * * @$ `( *@ * $ `(2 * * @@ $ @$ <r ( @t `(  ?&`( @'@}0v`(` g & ,< "`P `T  6 4<rՐ (` $ 4@!| 6`,<rǐ X0ဢ 2!`0`"`0$#8  @ `   * " * $ `0 !H`L0#8  @ `   * " * $ HL@2  4( *  ?H  H 2  L ?H  H 2a`L ?Ha` 2 L@` `   * @"  * -&   8$  /2 $   $ $  , 8$  /2 $   $ $ 8#8  @ `   * " * @$ $   8$  4  ( $ 4!.  # ",@@@ l`l@@|"@#!. x #@  8 "<r<r 6   D ,  T`А <r ɫ @P h!i 'P  ?  4'O`   * @"  , +O'T,? @@YB'XB@Y '\B@Y'`'d'h 'tD;@ @VP  ?㿘 "<   h p h!<!@&!D&!@1!H@P !@ "<   h`t`l"?&!㿘 "mÐ6 "א㿘 " hX<> P > & 6 "<#'& d(< & d<!& d2<!<!$& dJ 6 *2& d\88 8  `&& ,#& ,h<& 4` & 0p& 8p>! h>!(` ">!08  >!8 h p h h<!@&!@&!D @Ng D@㿘 P@ T@2  X@2 \ ̀   @S D`?㿘 "<$ 2 m.   @S D  h@_ D?  㿘<"`  T <r@ X @j@㿐 '' X  <@jS )<"` <r ! E 0<rA!  @  <r!@505 "<  @ ?&@   @2  4   h H`    0 !8 ?!(?! 7?@Nx @ " !0 0    ' 0'ذ㿈 h!`D  `&  2  J @z| !>'H` l` h'& l !! 2>*!H` `2"`@zk0A'H` l` h'& l !!  !!!H` `2"`i㿘 <@!!@ h D @ 㿘 h  D @&`X㿘 h D``X`@? <"`<r` !x`Ȁ`_?k Z?a V !<"  Naa@!@ a D B? a `h6a`H b <r` !`ߘ? a`i6aa@   b <r` !`Ș a <r` "ƿ`a?# @6a`ld #㿈 ?`2 "<rƪ"@ 2@<rƢ"p "k< 2<"`<r "  ƍ@ `P Ā@`T ̀2 `X `X@2`X`\" "`X  Ț`P`\<r#` #\#d"Ȗf˰<`$  @2*`8`h  `<  `<#<a@ ;!8&!@   !< "!( !(!,"@ @ "!h!8`@2!h!<` @2 !h`2!h!,`@" !h!h@"`p ,&`p>! `p & 8``>!0`` 0,& 0& 4>!8& ,>!(`&6 "`*6 $`.6 &`26 (@ "`D`@ 8  `&!#!:  h& @ & @`@& < "< @ 6 *@`J6 *(!D!@a@ ! "< * &!@ h t 0 h l   "<  2lt&!@a@&!D"R <r #8Ş2m㿘<@C#X<63#㿘 <"` <r#ń @K㿘 <"`  <r@#@p<@!!@ h D C z㿘 <"` <r@#M@<@!!@ h D   Ȓ㿘<"``<r` #-`  @ 5  4  P& P㿘@d㿘   2 h `T@Œ  㿘 <"`  <r@#@ <@!!@ h D ɒ  㿐  <"`@  ` <s` H%$(,#\`2`"[? $$"W?`h Lb`"0 / J?$  E`L @SϞ?   @   4  @S5 @3M 4  % `L @S$    @ " @SD@1Nj@4؋@!@㿘 e T<" & *` *  *  *  `h P:  * <@%'|<"`<s & 2 X @Sg|'<s4"  `h|`` #\#``h H#\#`` E |?"?  $@Ѱ@K0 @S  @S!P!P  ` 0 2 4 "4 㿘  S  ``  @  2` @b =@ =`h.`8`<`4` $`4$`8<!@```` $`(@!P!p $!p`(@`8  ?<s  $`8`$& #@  @  ?  `hap T@  `, /2` : @` @ `@c㿘`( '<?@ʐ@ap<" "@ *` *  *  *  :  ,*  $@ 0$``` 0 &`@ݤ ap`&`&` &` ,   >`&`&`&`&`㿘''<s` @  @R3 @RB # `8` 0$`8 #@@2x`h  D G!x ";@J!!xp$t$p3<x@T <"$P$T ?''<"` <s`!` ®#\@uT @u@Q@u} ?㿈'''' h`T  @ @ 6@ 6p㿘!P@!p"!P `?@ `?&!p<sd!H㿘!P @!p"!P `?@ `?&!p<sK!H㿈''''ޒ  `㿈''''  `㿘 T<"`<s !x  Wpp@@)<sp? @  ` @Q+` @Q$ @Q3` #b  !   `  , 0ۚ  8  ?<sԐ 0$ 8 $| #@ސ@ܐpǠ?㿘#<` `` @P2` b <s` !Ȓ` 2   @   4 `  ? h Po̔ @ @PǞ`( #㿘 T`h  X   X<"` <s ` "H`Ț@`<"<& *` *  *  *  : *   p*`h`H #\#`    a8a(?a ??7u` @ @Pi<s"x`,'&`, ŀ "㿘    `,   ? 8  hL% ` `, `0p  t2 $" %2  ( 8 ,@(  2  !h!h   ` 0 2 4 "4 㿘  <s#80' 8 2`<s#X`   2` 2 @*"   2` 2 :" & #`"& 㿘   8 2 <sp#  " "@& & & 㿘`h  %<'<-<s+<tH`⌀ <sU# `h@ D@  H   @G H&&  & &  % ⌀ #<H1``h L`  d `b  Y db H`(` H ! &  @O& ,& 0 &   X % & `h  D@&  & 4& H`$ $H㿘 h 4`? d& 4  @<t `c6<tؐ @1 8 2 <sΐ"  " "@&& !|!h !h`?@ `?$!|<s#!h!Pa!h!P!P@@ 8 <t   "h$#  D`@  4<H?$"H2 #㿈  h 8 `D  4`& 4 2  J @r  8 >'H` $` '& $ ! 8  2>ƞ!H` `2"`@r0A'H` $` '& $ ! 8   ! 8 !H` `2"`㿘 ??!h!h" `   2` @ 󀢀@ 8  4`?$ 4ΐ @㿘 @"< (!@@ @,&@ 8`  4` $ 4$ 8  瀤@߰ 㿘!XӐ!t"!X `?@ `?&!t<tw 㿘!`!x"!` `?@ `?&!x<t`!(㿘  ??@&@ @  2` @ @@@ 8`  4` $ 4$ 8  〤@۰ 㿘!Xǐ!t"!X `?@ `?&!t<t 㿘!`!x"!` `?@ `?&!x<t!(㿘@, ?   2 2`  @! , g3 , 0  @ ? @" 㿘ah ah  2    2` @ 2  "" 8`   4  "4 4` & 4& 8   ah"` ,\ , "8a| 8`2 4` & 4& 82  8 2ah<sw"ah2a|` &`a|ah &a|"`&& &ah 4 & 4  @ aXat &at (@`# ,   @[  QV <!@cp y$ (<a@!t$ ( 0 @ 2 8  @   X `?     8  ?<s" 0& 8 $ #?#& 0& , ( 8 ,$& 0 8  ?<s" 0 ?& 8 $ #㿘 h H@!t  \,     @ !|    @w !x, @ < H`   @ !|    @ǘ 㿘     2`   ` 2   @  4  4 㿘 <"`  <t@!X` @~`h Xo S<8?` 2   @n  4  ) 0@  ` @K ` 2  @R  &P 6 $P $P , @ IA⌀ <t`,!( ` @Kj㿘`( '<?eat<" "@ *` *  *  *  :  ,*  $@ 0$``` 0 &`@ݤ at``ah&``&`` &`` `,  &`&`&`&`&`x`h D!A  @C!t$x$tG@ `" $ax   $$<@A<"$P$T`hH`  ''''<"` <t`!` #\@n: @nِ@7@nc+ "'?#<s ɒaXat &at (@x 8` ib  $ 8 #r2?㿈'''' h`\  @Qg 6@*@%1<s@@!X!t $!t(@08` !"  @&8`Ȓ #*@2@㿐 T   <"`<t " `@: %<#<La@@< ?<t"8a@!0@$L?& `  : %<#<Pa@@<⌀ <t h|"hє a@!0@$P @@   !8; !(; !  ; 3 !t!t@Ӯ+<t!t3⌀ ` `,b `  Ȇ  `0#\ 6N  @Iܞ @IŞ"2``8 2`<s"``" "@$$`!|!h !h`?@ `?$!|<sn#!h!P\!h!P!P@@Im`` "`P⌀ _<t O"[`8@ =42`8 2`<s>"``" "@$$`!|!h !h`?@ `?$!|<s(#!h!P\b!h!P!P@@'⌀ <t"`8@? <!@a$`(`U!`!x $!x`(@⌀ <t"`8 2 ?<s"  !t$`8`$ #!t23!t㿘 ? ??Y%at   , 0  82&` `&`&`&``,$` `ah&`&`&`&`㿀! ```@@!at$ax$at`2@ at< `h D@<"$`P$`T` `?'`'<"`<t`y"@l @l@@lH+ "'?%<s@ a`ax &ax (@] 8` N  $ 8` #W2?㿘 T<"`<t #2  @@   !8; !(; !  ; 3 ktt@+<tt"  c@` ``   `,`0  `B8` 2" P2"`8 2`<s"``" "@$$`!|!h !h`?@ `?$!|<sސ#!h!P[!h!P!P@@ݐ" Z<t Ő"V`8l@Cє  ="2"`8 2`<s"``" "@$$`!|!h !h`?@ `?$!|<s#!h!PZ֐!h!P!P@@w" <t"`8 <t}#``ʒ!X!t $!t`(@y`8 2 ?<si"  t$`8`$ #rt2Ht㿈''''&  `㿈''''  ٔ`㿈''''  o`㿈''''      R`㿘  ?` `       瀤 ?㿐<"&@ *` *   *  *  a: * 2< X@<"`  <t`#`   `h ` H#\L  = a?# @4a  `@F` l @FÞ`$ # ` @F @F` #& $?㿘<"<  "@ *` *  *  *  : *    <"`$ <u Ȓ B @> =  < ?2  & "0& $& ` @ ``ƀ` 6`  & b <u !   㾈  'H'L  (3@>H @>E '<$`h H`X$ 2/<;<9<⌀  <u X  7<5< ⌀ `<t#Ӓ p $Jb $ * *  *  *  a : 2* $  -<t$ ⌀ `  `@`@    <($⌀ <t# $ ⌀ <u 0t? "0$`$ ` ⌀ <u _=u  2 @"w   X⌀ `<u!H C  "  $  "<?2 * @b*` $ * *  *  `h*  H `: #\* `L  <(:`H$L$$ $$ @=E ⌀ <u! ⌀`6   HL &  ` "$x $     ?? < @ 0; # ( 0# T  2 `      <\"@`4"@ a+a@d8 d L<a@ ,g 0 Z0  <"`[<u @! @U 0 ` !@ <\`@4" #$ < L!@@ @ <`  2! hD D01 24 0`h H8` @ &8 # @2  0 @2 0 @2 0 @2 0자 2 0@& L#  0 0@QlQ 2    "`"& & ǐ  < "   뼐 ``` ""`"`㿘  @ CW6<"`` <u@!`@ h x`D@ %?< &`P h`H8 `@?  T  ?R4Qt<!@ &`L㿘A  ?Qc<!@ & L㾸<"`<u ! `@ 'ؐI7 h`H`(`@ؖ    ̐ ` ` `"`"&`&`㾸<"`<u " l`@ 'ؐ7 h H``P.2`@ؘ    ` ` `"`"&`&`㾸<"`<u "  6`@ 7ܐ' h`H`D`@ؖ@   ` ` ` `"`"&`&`㿘<"`<u "8 `@꫐ h`HH€`@ Q;㿈''  2` *`@@  'P P6 2  ?ܒ N㿈`?<"` ` <u@"P`@@@ Y` 2 `` <u@"x`@` K?`<u b @/K  /<u` %<'<u Mڐ` $ @/8 b``@`  <!  ․  '@;&h'`H8`@  <!@&`LP@ oM㿘       `""& &    ;<"`<u @"; @ ? <u@#2 @ <u @#8) @!Ґ < "<!@  h`t`l"?$!`h`H,€ @ PQPr㿘<"`<u #h `@`     (  ?  <!@&`L㾨<"`<u # `@ h? H@ /$@:~B` " ?` <u@#`@?! 7'@:i'' ] h8`H@`@ 8   ܔ `` <u@#`@` `"`"&`&`㿘<"`   <v  @ @ @t@ "`"&&< "< @@@ h`t`l"?$!`h H@`<㿘`   `""&&<"` <v`   (@ @`@@6 ?   ;   "@ N@ >[ 2  Nǒ <v @ P@      NG  <v @ @O:蝐蛐 h`H8`@@ON ` "<  OX`L㿘3s h`H M\  !! `2 h\  !! `2  h "  h ?+ h`H ?  hD` 2     2H  H` 㿘<b&@* @*`@ *`@*` h@ H:`*` <  /`  @@ @@` # 㿘 < 蒖<&<"<$ *` *  *  *  : *   D;@  @>Ò 0㿘 < `<<"<$ *@ *`@ *`@ *`@ :`*`  3Ɛ  㿈!<" <v 6 ''''@cߔ " <vސ 㿈!<" <vԐ!6@ h `D ''''@c” " <v! 㿀 ''5< <v!86@ h`D ""''@c  <v!Ph@ `''''?3<b <v!h 6 h`D """'Ԓ@c{ b <v!yp '''''3<b <vi! h`D """'ܒ@cW b <v!U В ?\ '  @''@7~ '''''?''?p'x'|!<" <v!Ȓ.6 h`D@c"" <v! `" А \'`'   @'''@7E ''|'''''?'?p'x!<"  <v"6 B h`D@b" <v"  $h` @'''''''7@'5< <v@Ȑ"8 h`D """'Ԓ@b  <v"Ph@`''''''?<"`<v"h <  /@ ?6&2 7@. 2`&& 7@h`D &&&'Ԓ@bo ?b< b67@hD&&&'@bZ b <v"Xh` @'' '??''''3<b <v"?  hD@b4 b <v"2㿘    ?@6o` `$ $ $ $`$@㿘` <  "<!@ @ @ h`t`l"?&!`h@` ''''''''''''3<b <v"Ȓ   h`D ""''Ԓ@aє b <v"ϒx` ''''''''3<b <v#  h`D ""''@a b <v#h@ `''''''''''''3<b <v#0  7@ h`D ""''Ԓ@au b <v#Psh@ `''''''''3<b <v#h] 7 h`D """'Ԓ@aJ b <v#Hx@ `''''''3<b <v#4  h`D ""''@a# b <v#!`  '''''?'''''?3<b <v# hD@` b <v#㿈!<" <v#@57 h ''''@`ݔ " <w ے "@ p 㿘@3v  ` &@ & p&  㿘` @3h` ` ?&@ `?" `?" `? " ?"@`"@"@`"@! `"@`"@?"@`"@` "@$ p$  㿘`@3  ` @T  " $ p$ 㿘`̔  `@3 ` ` " ""`&@$`p$` ` <wO 8? , , `|$`x@2.` `Ē@$`$`ȁ㿘@t `@tw `D@ ` ` `$` `(` `,` `0` 8`8` `@` `H` `D`$ 8`P`(  8`X`,  @  C8```4   @8`h`< @ @  D8`p 0@? <)   ` `$ `H@`&@@<w hߒ#? !<" <wՐ @ݔ"" <w ɒ  Ē@" &&&㿘`@2[ ` "@`"`"`"` `&@$`p$` ` <w  ?.``$@2?    <w" @a(" "  ``p `l@$`l$`p㿘`@2# ` @X ` ?&@ `?" `?" `? " ?"@`"@"@`"@! `"@`"@?"@`"@` "@$ p$  㿘`@1ה ` @   `@1͔  @`" $`p$` 㿘`@1 ` ` @1`  @  " $ p$ 㿘`@1 ` @ @` ?&@ `?" `?" `? " ?"@`"@"@`"@! `"@`"@?"@`"@` "@$ p$  㿘  `$`  6 `@1M ` "`"@ `&@$ p$ `,*$ x$ | $   Ĕ  $ $ ȁ 㿘@ t `@H  t&@ @<w7!0 <"` <wo!h  @w"  @@<wa!'?@ "`` `@` ?@`  ` <w@  `0 <w!@?0<w<!&&   !?# = ; # ; #  ;  @ #   㿘@ @C 㿘@ `@9G @& `&$`&(` &,`&0` >8`&@`&H` &D`$ >P`(  >X`,  @  C>``4   @>h`<  @  D>p 6?  <(@  & &$&H 㿘@ `@S  D@1 $ @0E ` @& `&$`&(` &,`&0` >8`&@`&H` &D`$ >P`(  >X`,  @  C>``4   @>h`<  @  D>p 6?  <(@  & &$&H 㿘 ̰  `@/  ` &@ $ p$ `,*$ x$ |$  Ĕ  $ $ ȁ㿘@ t `@l&  t&@ @<w" ? <"` <w"X  @"?@8"*  㿘 "@㿘@ 0`@ c&> & &`&&&&@   `>(@@9 >0`@(@9{ >8`(@9u   >@>X&d>H>P@ 㿘<! ?   2   ? <w"a, `@㿘<"`<x  @ 2  @td  <?!@# T$ $ <"t$ <`|# L# H@s*  㿘 @ "<"`<x  m  `?Ő d"` @l  d5  `2   2 㿘 @ 2  ﷒  ?@0 & @ 㿘 @ V& @㿘<  @o? h!@"!``@"@! @" 2!㿘 h!`@   !!`@2  ?!"!c 6!K;㿘 h!@`&!<!@!`d@, `2  hB D0@@l@ 㿘 <@#p `?<b  <x Ɛ H T @$`;?#!a 4!$!  k    !h!!@@<!h!@@q$! ^ !h!h@!P!P@b!,Jɐ`ˠ <x  h!@  d!@$!@< |& H& & p@  $ < $ & H<   @k 㿘 T @ @""   #㿘 ? & < $ $2@ "$@ 2@"@ NL㿈 T?   @/n  '`h `H0 @[_ 0& & H㿘 T``ޱ h ( H4€ `@y$B@㿘 T㿘    h?SD -@/- <  $`$<$`$@$`"`$ `$` @rZ<<#0`$ P$ H$ T   & @x $`<  ( @j 㿘<  $ ,  2 %  $  D ? "  @@-F `$ $  < ?&  <`( @j 9㿘@  㿘@ `''<"`" <x #h @В@@  ?''& '̒@ZJ   ?㿘 @hS <  @Y 2 @h0      & ?㿘@? " $ p$  㿘@._ B@`` & 2 @,  㿘@.L B@`` &@@`2@,  㿈!<" <y 06 ''''@Yؔ " <yא H㿈!<" <y͐ `6@ h `D ''''@Y " <y xp А  ''?'5< <y 6@ h`D ""''ܒ@Y  <y @``'p'x't'P'T'X'`'d'h<b  <y { 6`h`7`Dp &&&'\P@Yg " "`h `D&'T'X'\P@YV " <y Tߞ 'x'|'p'h'l't<"`<y> `7| '| "<   `| '|` |  | '|`| '| hp`Dh"x ""` 'd@Y X"  <y! |t @ 2? 'p't'x'`'d'h'P'T'X3<b <y!  hp7`D `"""'\P@Xؔ b <y!8֒ В ?\ '  @''@, '''''?''?p'x'|!<" <y!P6 h`D@X" <y!p`" А `'\'   @'''@,Ɛ '''''?''?p'x'| <"`<y!t6 B"'' h`D@Xa" <y!p_ 6@``'`'h'L'd'l'p't'x'P'T'X'@'D'H<b  <y!< 77@'p` @<!@ 'p't`'x`h `D&&&P'\@X m c "p "'p  2`h 'p" <y!  #p   '(',?8'0" <y!7@`h(`D&&'X'\P@W " <y"`@`'p'x p't?`?P'X'\'h'l3<b <y"(ʒ `h 7`D@W` b`<y"@㿘    ?@+` `$ $  $ $`$@$`㿘` ` `x@``''''''''''''!<" <y"X r `h77`D """'@W^ ݭݪ"`<y"xVxВ`?''''''#<b <y"= h77`D """'@W) xub`<y"!@` 'h'p'x'|'\'`'d'l't'T'@'D'H'P'X5< <y"  7@ hh7`D P"""@'L@V :`<y"@` в'`'h'l'L'd'p't'x'D'P'T'X'@'H5< <y"Ȓ 7 h@7`D `"""P'\@V `<y#@``'p'x'`'d'h't3<b <y#( `h7`D p"""`'l@V ֒b`<y#@㾸 '('X'h'p't','0'4'@'H?`'l'x'8'D'L'P!H!H ` \X@?('0'4'h?' '$?p'l?H'D'x'P '(<b  <y#X<y#p<y#x A h 7`D@V5(܄b`<y#07d`@'h'ld'p'|< '\'`'t'x'T'@'D'H'P 'X?060 ?0/  't 't 't 't5< <y+`@#27@hh7`D P"""@'L@Uٔ (`<y#Ԓ㿈!<" <yɐ#Ȓ h@*@ ''''@U   @''''@U " <y# "@ p 㿘&@`@(A`  @ &@$ p$  㿘` &@@(-  ?` @ <h!Ԛ`$@ &`<h!`$@ <h!#@`#@<h!#@  `<h!#@`#@<h!#@ `<h!#@ ` ;  #@#``<h!#@`  <h!#@`#@#` `<h!<h!#@`! <h!#@`#@#` `<h!<h!#@` &@`` &@&``&@$p$  㿘`&@ @'   ?@`" $`p$` 㿘`&@@' ` $@ @ `&@$p$  㿘̠` @`&@@@'s`@ $  $  $ &@$p$ ` <z ? , , |$x@'S.` Ē@$$ȁ㿘`@`&@@@'?@    ? $  $ $   $ $ &@$p$   <z| 8?, $@' ` <z" `h" "   p l@$l$p㿘`&@ @&  ?@@1&@  `&@`&@k`  <h!Ԛ`&@ &`<h!`&@ <h!#@ `#@<h!#@  `<h!#@ `#@<h!#@ `<h!#@ ` ;  #@#``<h!#@`  <h!#@ `#@#` `<h!<h!#@`! <h!#@ `#@#` `<h!<h!#@` &@$p$  㿘`&@ @&q  ?@@  <h!Ԛ`&@&`<h!`&@ <h!#@`#@<h!#@  `<h!#@`#@<h!#@ `<h!#@ ` ;  #@#``<h!#@`  <h!#@`#@#` `<h!<h!#@`! <h!#@`#@#` `<h!<h!#@`#@$p$  㿘`&@ @%  ?@@# <h!Ԛ`&@&`<h!`&@ <h!#@`#@<h!#@  `<h!#@`#@<h!#@ `<h!#@ ` ;  #@#``<h!#@`  <h!#@`#@#` `<h!<h!#@`! <h!#@`#@#` `<h!<h!#@`  @ " $p$ 㿘`&@ @%l  ?@@ &@  `<h!Ԛ`&@&`<h!`&@ <h!#@`#@<h!#@  `<h!#@`#@<h!#@ `<h!#@ ` ;  #@#``<h!#@`  <h!#@`#@#` `<h!<h!#@`! <h!#@`#@#` `<h!<h!#@` ?   2 &@`&@`&@$p$  㿘`&@ @$ݐ   ?@@ `&@ @$̐  ?@@" $p$ 㿘`@&@@`@$@ `@ $   @`@$@  ?@ " $p$ 㿘̢` `&@@$   @ $@ """  `2 "&@`&@$p$ ,`*`$x$|$Ē@  $$ȁ 㿘@`@ t e`` 8 < a+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@  g `" `@`"@@`" &@@<zK p <"` <z)  @1"  @@`>`` 5`@` ?@`%  @ (<z@ ``T@  <z@  `@`@`` ?@` <z@  Բ`0<z <z!?0<z!@$$ 㾸@# `    ?&` =   >@    @ >@ ` &` ?>`&`  >`  @ >` `h e   8 < a+ `@ < &  *&$ &( &, &0   >`   >`  X  >` $ @ >` ( *&H 0  >` 4  >` 8  >` < @ >` @   D>` H  @  E>` P   E>``h 6`h  # `$@$ D @ &`$@"ِ`(`$`   2<"` <z !h@"Ŕ  ?6`h   @ &` 㿘`@&@@@"`@    ?$  $  $ &@$p$   㿘@ `*e @ 8 < a+ `@ <  & `*&$`&(` &,`&0`  >8`  >8`  >@`  @ >@`$ *&H`,  >P`0  >P`4  >X`8 @ >X`<   D>``D  @  E>h`L   E>p 6㿘@ ` @ "``   >`   @ >`    @  C >`   @  B  `>6 @ d` 8 < a+ `@ < & `*&$` &(`&,`&0`  >8`  >8`   >@`$ @ >@`( *&H`0  >P`4  >P`8  >X`< @ >X`@   D>``H  @  E>h`P   E>p 6㿘@ `'  D@#+@`@ $@! `   `2@а?` e` 8 < a+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@ @ d` 8 < a+ `@ < & `*&$` &(`&,`&0`  >8`  >8`   >@`$ @ >@`( *&H`0  >P`4  >P`8  >X`< @ >X`@   D>``H  @  E>h`P   E>p 6㿘@`@` e` 8 < a+ `@ < & `*& $` & (`& ,`& 0`  > 8`  > 8` `X  > @`$ @ > @`( *& H`0  > P`4  > P`8  > X`< @ > X`@   D> ``H  @  E> h`P   E> p 6` &ː 㿘̠`  @`&@@@ "`@`  $$p$ ,`*`$x$|$Ē@  $$ȁ㿘`@ t e` 8 < a+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@ "/% " <z!? <"` <zِ! @z"?@8"*  㿘@`@t e`` 8 < a+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@  < @`@`' @`<zF!.?&@@<z"(:"? <"` <z0"X@z8"Ȳ"<z""  Ē@zI"' 㿘@`@` "`   > `   @ > `    @  C > `   @  B  `> 6 @ e`@ 8 < a+ `@ < & `*& $`& (` & ,`& 0`  > 8`  > 8`  > @`  @ > @`$ *& H`,  > P`0  > P`4  > X`8 @ > X`<   D> ``D  @  E> h`L   E> p`T 6`@`&@`"@"``"  㿘@ `@ ` D@@`@ $@ `   `2@i?` e` 8 < a+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@t @. D@` e` 8 < a+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@ 2 @` "`   >`   @ >`    @  C >`   @  B  `>6 @ d`@ 8 < a+ `@ < & `*&$`&(` &,`&0`  >8`  >8`  >@`  @ >@`$ *&H`,  >P`0  >P`4  >X`8 @ >X`<   D>``D  @  E>h`L   E>p 6㿘@ `  @` "`   8``   @ 8``    @  C 8``  @ @  B  `8`0@ @ e`@ 8 < a+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8`  8`@`  @ 8`@`$ * `H`,  8`P`0  8`P`4  8`X`8 @ 8`X`<   D8```D  @  E8`h`L   E8`p@`T 0@@` "`   >`   @ >`    @  C >`   @  B  `>6 @ d`@ 8 < a+ `@ < & `*&$`&(` &,`&0`  >8`  >8`  >@`  @ >@`$ *&H`,  >P`0  >P`4  >X`8 @ >X`<   D>``D  @  E>h`L   E>p 6㿘@ ` @` e` 8 < a+ `@ < ` `* `$` `(` `,` `0`  8`8`  8`8` `X  8`@`$ @ 8`@`( * `H`0  8`P`4  8`P`8  8`X`< @ 8`X`@   D8```H  @  E8`h`P   E8`p@ 0@ @` "`   >`   @ >`    @  C >`   @  B  `>6 @ d`@ 8 < a+ `@ < & `*&$`&(` &,`&0`  >8`  >8`  >@`  @ >@`$ *&H`,  >P`0  >P`4  >X`8 @ >X`<   D>``D  @  E>h`L   E>p 6 @`@ e``8 < !( <'`+@ @'` '`'`'`  ?`  ?` `X  ?`$ @ ?`( *'`0  ?`4  ?`8  ?`< @ ?`@   D?`H  @  E?`P   E? 7 K @    >0`   @ >0`@  >8` @ >8`@  >@`  >@`@  >H`  >H`@  >P` @ >P`@  >X` @ >XM  @`@ e``8 < !( <'`+@ @'` '`'`'`  ?`  ?` `X  ?`$ @ ?`( *'`0  ?`4  ?`8  ?`< @ ?`@   D?`H  @  E?`P   E? 7 $ @ &`@`&@`&@`& @`&@`&@`&@  > `  > 鹐  @`@ e``8 < !( <'`+@ @'` '`'`'`  ?`  ?` `X  ?`$ @ ?`( *'`0  ?`4  ?`8  ?`< @ ?`@   D?`H  @  E?`P   E? 7  @ &``&dA 㿘@`@` "`   > `   @ > `    @  C > `   @  B  `> 6 @ e`@ 8 < a+ `@ < & `*& $`& (` & ,`& 0`  > 8`  > 8`  > @`  @ > @`$ *& H`,  > P`0  > P`4  > X`8 @ > X`<   D> ``D  @  E> h`L   E> p`T 6`  @"`"`袐 㿀#<  @ c$''+?'$c$(c$c$2@ $c$@ 2@"@ 2 @ &2 >@ ><{"0( >㿘< #$" P    ( (@ , ,@ % % `   2 " #<]#<]#㿘 8 2* *@& 8 D<{ "` @& D` & @ @& D & @@ؐ<& ,Ŕ 㿘%<@ <7 '!i   `h`$ 2 `D `$2  < @@"   @  ?$ @@   2  8 * & 8C #< #$   2$  5 # 2 @@  㿘 !<  #(@ @ #( $``$#( @ <!l`& & ``H K(  `ǒ  2& `  ``H @`L㿘 `!ld h@`H    $`D<{6#?` 0@Q 2ٰ? $@ 2 hŰ?  D  2 * * @  h*@  D    h+ D`  Ho`'8 %'<% ! ?"@"`堔+ 嘐*@ @ "`@  \?$`$ $@!<  #(@l @  #( $`< `$#($`  D`@Y`<`$l $ L`<{@ Vc$ Hd@J H` @' %  @Ð  ` `?$@<?ꀦ  חHo`8!" 0.?"+?0)@א&? #?!>` <| `਀  <|ڐ ? <|Ӑ   %`<`"`8?㿈  <"`  !<| @`@  ''''@BΔ ?㿈   <"` |!<| @s`@ 2'?'쀤'X''@@B  @㿘=  6     .`%"@!$@ H 㿘@Z D㿘 D @n& D㿘 `8@  @i  <|!<`(?  &"  є &   <(`@`@<(`x"&`8&`<&`@&`D&`4@L H'D@T'@ @T#<  c(@L@L < b ` $ $ `Xc( D `@$c(<'T$L`<{@ c$H H@ &   &  Ѐ 2  <|`Ґ! ?㿘`@ ?&`@   <)8   6`  `` ?<|!h?㿘 T t!   `<"`<|! 0 `<|!h@ ի0@s @B㿐Ho`'?'""堔+ 嘐*@ @ "`  U?$$ @!<  #(@ @ #( $`< `$#($``  D`@`<`$l $ L`<{@ c$ H H@ېd<)  EHo`!!%%%* %*@ @ # `㿘 t!. T  !<<"`*<|! 0%" <|`А! `Ѐ  ``<|0 ` <|0 "  <|ܐ"0ِ"8@`0@`@AG@Vr+㿘`<|<&!*` €   ?<|"h?"?㿘<!@< c,  @; `   <"`<|#H "`<|# `@ڐ`<}` ``2@ 6 @ & `< & ` & `  & 6 6a@& 006 46 & L& P @& T!0 " & \& H & 4 ` <* b#0@  &"@ @##0a@$,㿘  <`"<}F H "` <} P` `8 4 ` <*`"@ .@ 42#  02 "  ` `? " " &" @0 ׀㿘!< #4 @ @㿘< #4 @    @֞㿘< #4!T!D !<@؞ ^   @㿘!<" <} L @ !   2M<@X@ G@#p@6 8$X" > @<}" g 6\ $\1 !\4@Ml 1 .!\< #\ @L+< 06@>* 2 @M<} & <!@  @ #p$ $X$ @?c0<} % @2^ 㿘<"`<}    <@ X@ @#p@28& X㿘 <"`<}!  H< <#0a@@& H!0 "@& \㿘  H  <"`<}!(Ԓ  H?& H㿘<b  <}Ɛ!@< c4 @─  <}!h<" %< *`  `<a@$ \ `*`@5#4 @0 '<}!─`<}0!<" *` `%<}─   82 H  \w  ┒`*`㿘<b  <}d!/<⠔ -</* "  8 $ 8 2 8*@  *@ 1@%< )<} H 2' 8@2"@ \@b "- $@ 8@ " @ i  @=`90?$0@ 2 Hɓ*< #0< @@c, "#p"@{ڐ@{ǐ@{ʐ@{"@{*@{7@{C@{@{@{@{@㿘 !< `< c`$#T @s<}c0@E“Ho`>?"`"@堔+ 嘐*@ @ "H*o`@Y#ݐ<"`<}f#8< ct 2ct "ctct<*` !@*  * < #< "cX"\   '< V5< cXH/ qH*/ cX @  a@#\1$cX@dF)` 0<}#` ,cT <} #!< #@  &!T#@@ &!T@^e#@ "P P cT ``@"cT`` 2<}&cTݐ#lz #@]Ӑ@X㿘<  #D @< P< cT B"P <}# < #Ē @] ?<~ 0cD @f|  @fv  < < cx  "cx<~  ("cx<-!@@]_ <~ P0 < c` @@]cD @㿘< #D @{< cP !< ? E"cP#T<~#T\ #T` < < c|  5"c|<~O 1cD"#|  sc <  d#l{!#T`<~= $#TH/ 堔+ 嘐*@ @ "H*o`cD @,. yr@y<@yܐ{@yɐ}@y̐@y΋@㿘<"`<~"ٔ!Ѐ < @/< <!@@ " ` aȀ@   ` aȀ@<   `  `2  .!&!&" !Ѐ<   "@( " 㿐<"` <~`h"0`x`|~`u< # 9#%<~─   l!Ԑh  ( , % k#\!Ԁ2#`P @  ((@ ,,@ % % `  $@ ┰ 㿘!Ԣ l<"`<~"3`"!р " <~%# ,`%!Ԓ (  .!р <~#0K!Ҁ .?  .!  2  $` `2 "`!Ā  㿘` @ ```# `aĀ2a`8"`82  `뀦 ` @Ӟ 㿐`0 <"`  <~ #Puhx|#`#\ h " ` <]#ܐ` @ t`(`P.tx -S `>  @─  <~#k N<]Z<]  "<]n#<]k#i# ` @e<]\#A─ <~E# 0!ͪ  (@!ب  <1"$ $  $  $ ─ <~"#  $!$!$!`$ &`% $ 22 `<]#)?`|  ─ <~#-`l @ X<]#㿘!<"  < 0`  `x`u`| (ϒ`P " < % @ ( ,< p&P&H@ u H<]c<]#Ё㿘<"` < 0`  `x`h`|@ .`u (`P <]<]##Ё㿘<"` < 0`  `x`h`|  @  F  @<]#Ё㿘<"`< n< # '< l @ ( (@, ,@ % % ` i @\v!0 ߔ l<@!㿘!<"`<!@3  @Q!р` ( !(┠ l  ─ <!`/?=-ٔ 6 << !# " <! .!.!ѐ + <2 !   @\㿘 T<"`<͐! <Ɛ"< # )<~ c" ``  @`?    2   <"(0 6 !#耢  #p@[!,!㿘< # #<~<"`by `   @`?   < T !`` $`@ <'<~"`M `   @U`?   < `2`R# ` $` @<`     ` @)@J㿘<"` !< #<"H` a# "41!Ȁ%<a@ ! #< bp!!Ӏ  ## " #!Ȁ"#@ # " 1!Ȁ<!@"@1#uދ@u@u@u}6@uuQ@um@up@u]@u`W@uM@uP@u=B@u5M@㿘``#T`2`  @_``?`2)`@<]`@<]"#@`2` ʡ  `<]#@ $`$`$`$` `$@&`<]$`$`㿘`T` #<] 2  @ `?`&@cв 2 cЁ㿘``! 2  2   &@@`8"`8 @耦  㿐< #@` `4'!T  <  Đ <]+c %<]`   8@@ؐ  &@`  & ($`d$`p <]<]#㿘<"`< <h"㿐!<" < @< &`&X``&<]<h#b(&  & ` w" <!^!<@T& " <!<R!0o@<h"㿐<"`<A!X@< &`&X`` &`  <]<h#b & W & `e` @!<& " <!x2@I<h"㿐!<" <!@< &`&X``&<]<h#b&  & H` @!<& " <!@<h"㿐!<" <А!@< &`&X``&<]<h#b&  & ` @!<& " <!@<h"㿘@&`&`&1<" <"p` & " <"8<h"<"`<"XP @5 <"`<j"xP @  <"`<U"PE @  <"`<@"Pe @ <"`<+"ؠP @ 㿐<"`<"@< &`&X`` &`  <]<h#b& + & @!<& " <#@<h"㿐!<" <ې#8@< &`&X``&<]<h#b&  & @!<& " <#X@<h"㿘<"`<#xX&`㿐ǖ <h@9<h"㿈!<!D  ' ' ''<"`<{# @2 ꀢ#( `  < l#<h(a' "< m`{< #@`<h` '`@    R "<h@d<h"㿘  !<Y!D  $ $ @ؐ <6pe  <hD@<h!"㿘   T<"`< # , (` 8 * 2 @00 㿘<"`@ !< !< " @< cD,@ b @  Fb  b @ !<䖠!8<]# $ <b@ < $  $ $  $ $ $ $ @$ $ $ $   (  b @!<!X0D, $" b @< !x&@   $ b @N0 ǎ <]<]##P`0  &`p 1+<)< $ '` &` 2 8 "82 H@ /Ր`(  ֐a"3   2 $㿘<  " @H)< *#D@ A@`              2  2 2 2 " < $@c@@ (@ Ā`*b @㿘<"`@< " < b @ݞ  ? ?&      < "c@@ (ƻ, 3 % 0" @ `!<` a!``` <* cD   " <s! @e㿘<"`@<a"H 4 㿘<"`@<T"h'  <"K 㿘  I <"`@<"9 ݐ<!@Q& \p N@o@o@oF@oT@o֐@x@\ ? a 0" ''''@9 '"?''@1ߔ 6 <#~ޒ㿐<"`< ~Ӓ  є  " 8< 0~Œ 0 & D& 8㿐<"`< P~   6 8< p~ 0*@& 8㿈  7'7 @?  << ` @0o       & @?Ґ?㿀<"`  < ~o <4`4``Ȗ `4`@@_B? <?@_<` ?&@" "`(  " """ &@$p$ 㿘@&`&<"`< ~0  @ "㿘 < # *    1<]3<]5<]7<]9<];<]<]#<]%<]'<])<] !<] <] <] <] $c$$%#$# #c"!#&#&c&&'#'c@ c㿘@㿘@`P@^є?  & `@ $@^`H   (#@ 4  , $  & ( & ,@  <h!&  ("@ & 㿘` &`@a``  <]` &c` ) `` %  <h!<h!"@  &@^L`X 2 ( & ,#@ <h!&  ("@ & 㿐@  ` &@’  <}o"h  &@  @ `D @`\@^M$ 7 @` `<"}O  &@ `$ $ @^`H  H @t $ @, %$ , $`@`$ (@` '@? $ ,#$ ,  .  "  :`@   㿘M      "  :`@ "  㿐@  ` &@<  <|"h  &@  @ `G @`&@`\@]Ė$ "7 @` `<"|Ɣ  &@h `$ "$ @]`H  H @t $ @, %$ , $`@`$ (@` '@? $ ,#$ ,   .@ &`@ &&`&@:    㿐@  ` &@  <|k"h  &@   @ `G @`&@`\@]F$ 7 @` `<"|H  &@ `$ $ @]`H  H @t $ @, %$ , $`@`$ (@` '@? $ ,#$ ,  .  "  :`@   㿐    &@H  <"h{  &@  @  B \@\Ֆ$ 7 @` `<"{ה  &@y `$ $ @\`H  H @t $ @, %$ , $`@`$ (@` '@? $ ,#$ ,`    ."@:    㿐  @ߐ?$`h@  ` &@Ԓ  <"h{  &@#  @   @\c$ "* @` `<"{e  $``@ `$ " @\,`H 2@  &`@&`&@:    㿘&@`@` @ `2  <h&@a &``&@:  "  㿘&@`@` @ `2   &@`&@:  "  㿐$ @[ 2   &":    㿘$@[ה    &  & ":    㿘@  ` &@  <z"h  &@_  @ `2@   & `&@:      "@ :`@      "@ :`@"    "@ p  㿘`&@ @`  ` u `<h!<h!$o  `&@$`p$` ?㿘@  ` &@  <"hzE  &@  @  ,?@` && `@y @X`@`@Z& ``?. $ . %. %@& (` ? & ,#& , 㿘`&@ @`  ` `<h!<h!$ `u `<h!<h!"@ 2? `<h!<h!"@ &@`&@$p$ 㿘`&@ @h`  `" `<h!<h!$ u `<h!<h!"@  `&@$`p$` ?㿘&@` @4` @ `    &@$ p$ ?㿘`&@@`     $` &@$`p$` ?㿘   "@$ p$ ?㿘@  ` &@  <y;"h  &@ݔ  @ ` @& ? * <!h< (㿘< @[Đ!㿘<@[֐#㿘   &`@O 0 <!x  &`@   㿘`& `@``  㿘` @@) `@&@<!PxՔ @   @x@ ?㿘@`& @@j@`  㿘@Y㿘@Yd㿈`P@Y$ "o ’` j `H  Hc @t $@,%,$$``@`@  ?``  @    B B  ?`&<` c?      @    $( &: c?     @  쀒@$,#$,㿘@`P@Y? ) e` $ s`H 2  & (  ;  &&  ,#@ &&    ("@ :  &&  㿘<"a<!w <]` &c` : `` %  <h!<h!"@  &@X`X 2 (, :  &&  ,#@ & &  ("@ :  && b!  < ,!`   %w (b!<!w  "@ :`@      "@ :`@"   㿘 `@ܒ `  .א㿘v " ֐㿘a   @&   ` .@ &&&㿘?   @& `  .㿘% "  ~   .{㿐  @g?$ h  @X$ " * " MT 2@  &`@`R&㿘  <h "a"L 㿘  "< 㿐 @W–$ & 㿘$@W  & &  㿘 &  㿘㿘 "@ p  㿘`   u `<h!<h!" ?   "@$ p$ ?㿐Y "t?  n& `@ X  $ `_?,$ ,%,%    ?   @    B B  ?`&>` c?      @    $( &: c?     @  @$, #$, 㿘    <h!<h!"@ u <h!<h!"@  2? <h!<h!"@ "`"$`p$` 㿘  "  <h!<h!"@ `u <h!<h!"@ ^   "$ p$ ?㿘`    H  "@&p& ?㿘~   "  "@ $ p$ ?㿘W   "@$ p$ ?㿘?  & ?㿐< #@` `'7 !T  <  u2 H<].cp %`   8@F  &`  & ($`d$`p  '<]#㿘<"`<t <h"㿐!<" <t @< &`&X``&<]<h#b&  & ` & " <tɐ <h"㿐<"`<t @< &`&X`` &`  <]<h#b& _ & `ܔ` & " <t!<h"㿐!<" <t~!(@< &`&X``&<]<h#b& ) & ` & " <t[!Hx<h"㿐!<" <tK!h@< &`&X``&<]<h#b&  & m` & " <t(!E\<h"㿘@&`&`&1<" <t!` & " <t!<h"<"`<s!P @1 <"`<s"P# @ <"`<sҐ"(PI @ <"`<s"HPg @ <"`<s"hP @ݒ 㿐<"`<s"@< &`&X`` &`  <]<h#b& 9 & & " <sj"<h"㿐!<" <sZ"@< &`&X``&<]<h#b&  & %& " <s6"Sj<h"㿘<"`<s&#b&`㿐ٖ <h1<h"㿈!<!D  ' ' ''<"`<r#( @2 ꀢ#( `  < r#H<h(a' "< `< #@`<h` '`@    Ӗ "<hn<h"㿘o  !<!D  ѐ<h$ $ @U <E|  <h濐<h!"㿘   T<"`< #xr  <  @  @`@  ` ` &?1$?` @2 ?`@+  ?㿘@Д*`` & @ 6` @ 逊 &>  % < "*`0 "䀢@   :@ :@ ?*   2 ?㿘@ Ҕ?2&`. `@`퀢`&< `?`? @ ? "`"<   `  `?㿘< " " @- 2  2 p  |@] #<#<cؔ@Lo <#q  ː  㿘  < p( `2* ?* # < #p( *  (  *"@㿘<  21<"p㿘` "<  ( ` h ` `??"  "29?  &@4 x ( 24   "( \  !! ``  < "  ?\  !! ` ?p h D '`$@'ഐ <<`(@0    / `!@@H <<`8@0*@ '` $쀢` ?# ?*  *@2@ 2@ @"U@ <<``@0 -Г7`h 2* `$ ` 4T*  #@  D; :T  Ĕ  H 0  '2'?# %??. @   *`*  2  2` ? *  *` 2  2 # T`@ ّ. "$T*?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @$`7`#'%<#<4 И h 2* ``$* @ :@  * @+@ `@/&  쀢 $?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@& $쀢 ?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@"`|x5 ԕ*- @ *`  ? ? *. 2` 6  * *@ 3 @ 2 @| ԑ5x* - *` "  Ж h@2@*  $ ` T*@ #@  D; T:@  Ā2 @ ?# !??-@@   *`*  2  2`   *  *` 2  2 # T ّ-@$T (@?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`&@TlЀ )7@ 73D 2? h3* `$+ 1 3h 3@* @ `*$+@  3h 3@* @ `*$+@  *  `?h 3* @ `( `$+  `?   $?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@& $ T` ?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@"|ԕ5 x*@ - *` T  ?? @ * @ +` 2` 3`  * *3 @ @ 2 @@| x5ԑ* @- *` "   @  쀢  ?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`& 쀢`?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`"|x5 ԕ*-  *``  ?? @ * @ +` 2` 3`   * *3 @ @ 2 @`|ԓ5 x*`@ - * "@k@ĒԴ@d@`@@@X@T@@@M@@H@`ȡ, h4, `@@8@4@t@@.@*@j@h@$@c@@@y, ``$,@쀢 "`?# @ `*`2@ ` @2 *`@7Ԑ@@@;@R@@@/@-@@'@@<`ȡ, h4, `@@Ӓ@ϐ@@'@ɒ@Ő@@@@@@@`, `$,2.`Ą h 2* `@``$*@? @ ? @ *+` 2` 3`   * *@ 3 @ 2 @`h2* ` $* " @;ߒ @;ܒ    @< @< / ؒ!/ ] #0 0!/ ] #x h`D'H'L`Ā@ ' $' " `<<H`L@+`0'؀ " ސ /``0'ؐ !H@'H@lH䀣 '<<`8@+L@ 'L""@"''L'@ |'` $'쀢 ?# ?*  *@2@ 2@ @"U@ <<``@+Ȑ[ 4lT6(74 D 2? h3 * `$+ 1 4 h 3@ *` `+ $+@  4 h 3@ *` `+ $+@  *  `?h 3 *` * ``$+  `? <<`@++T (  "6hC`Ȁ  2>`h3 *`   `$+1*@h4  3 *`  `*`$+   h4  3 *`  `*`$+   * @( 4  2 *`  `+ `$*  + `  @ { ܀`  ? ? *`* ? 2 2` ?  *`*  ? ?2  2 "܀   ? ? *`* ? 2 2` ?  *`*  ? ?2  2 `H" |x3 * + *`  ܀ ? ? *`* ? 2 2` ?  *`* ? ?2  2 |2 *`@ x*@ * "@﬒@@Ԡ@@@@@@֒@Ԓ@@Β@@`ȡ, h4, `@@zԠ@v@ﶒ@Β@p@l@﬒@朗@f@縷@a@, ``$,܀@?# @ `2 *`@` @ 2 *`@`@D@?@~@@6@2@r@p@+@j@&@`ȡ, h4, `@@Ԡ@@R@j@ @@H@F@@A@@W`, `$,2@/ Ą h 2* ܀ ` $* @? ? *`* ? 2 2` ?  *`*  ? ?2  2 h3* `$+ " T @9 @9 `   @9A@9Q耣 HL 'Hj'L /`ؒ!/`Z #0ؒ!/`Z #㿐h?`D'X``$'H'L'@ ``  ,`` !H?# ?*  *@2@ 2@ L @T <<La @)WLT "@L @2 <<LaH@(ؘ P?L<C2@< `   ` !!`2.@` ?# ?*  , @2@ 4 @` ?# ?*  *@2@ 2@ l +D@R "@: 2@BmX@ `0`?#?*  . @2@ 6 @H"X"@L@/  $@ $`0` `'` @s $֒   @U2 h' `( "hb h "      @Q` ͯ  w*` YX@ WX"@L@/  $@ $>`0` т`'` @ $~   @2 hΒ  ( "h h "      @Q2` W  *` !,`YB #02` ?# ?*  *@2@ 2@ $ 2"% X <` ?# ?*  *@2@ 2@ D@ @E Ȁ(#% "XT` ?# ?*  *@2@ 2@ XD@Β@( d ` @% X@e Ͷ Y``` I'` @o"`( l  @a"`  @E2 h ( "hRh "      @Pz` ̟   g<g!p *``?#?*  . @2@ 6 @H"X"L@@/  $@ $>`0` c`'` @ $_   @ޞ2 hЯ  ( "hh "      @P` 8  *` !,`X# #'@zv0 `0!,`X # 㿐 hD&  $' @7 |H5 x* - *`  *q   T@ %@ e  '`` $`?# ?*  *@2@ 2@ @"U@ <<a`@&E  @ @  ```І8 h 3  2@* @ @$  : `@  <\`"@?# ?*  *@2@ 2@ &` T"H`4  ```І8 h 3  2@* @ @$  : "#@`@  #@,``?# ?*  *@2@ 2@  ,`<<a@&,``?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @@"$$@* `?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`($@`  Е2` h 3*  ` `( $+ `* @ *``$?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@&`$ |`5  x*-  *`  ?? @ * @ +` 2` 3`  * * @ 3 @ 2 @@ |` x5* - *` "  ?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@"`̐@4Ԓ @4ђ    @4@5 -㿐 h.``̎ `D`$ ` $ ?# ?*  *@2@ 2@  T?# 4??+   * * 2`  2    +  H  @ ?#@@ :&@ `̓.` $   ?*  *@2@ 2@ l? 4#!??+   * *@ 2 @ 2 @ Q  + ( ƒ@ ?#`@: `̓.` $   ?*  *@2@ 2@ &? 4#!??+   * *@ 2 @ 2 @    +  Dz` @/ @'` $ ?# ?*  *@2@ 2@ @"U@<<a`@$K<\"@?# ?*  *@2@ 2@ $  T @? ?# 4??. * * 2`  2  @`@  @@?"  @` T  4`H Г2 h 3*   `( `$+ @  +@  T  T" $?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@$ $?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@% |6@  x*.@  *`  ?? @ * @ +` 2` 3`  * *3 @ @ 2 @@ |( x6@* .@ *` "   ?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`#@?'  4,``H  Е2` h 3*  ` `+@ $+ *  * $?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@$ $?? @ * @ +` 2` 3`  * *@ 3 @ 2 @@% |6@  x*.@  *`  ?? @ * @ +` 2` 3`  * * @ 3 @ 2 @@ | x6@* .@ *` " ?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @"#$@* ?? * . 2` 6   * *@ 3 @ 2 @+`#@2 @2 `   @2C@2S -` @砐㿐 h D Ā '  $`$ ZT@ː.Tl  Ѐ`)672D 2? h 3*  `$+ 1 2h 3@*  @ `*$+@  2h 3@*  @ `*$+@  *  `?h 3*  @ `( `$+  `?  @2' ?lT6 &  5 D Ȁ  > h@2* @`$* 4* h0@ 2*  `* $* @  h0@ 2*  `* $* @  * ++@ h0@ 2*  @`+ $*  * +   @?``?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @$` ?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @$  H| 2 x**  *` ` ? @ ? @ *+` 2` 3` ? * *@ 3 @ 2 @ |x3 *` + * "@b@廒'@\Ԡ@X@昒@寒@P@L@挒@抒@E@愒@@@噒 Ƞ, h4, @@2Ԡ@.@n@冒@(@$@d@b@@]@@@s<c, ``$,@` ? * 2? 2` 2*  @@@3@J@@@'@%@@@@4 Ƞh, 4, @@Ԡ@ɐ@ @!@Ò@忐@@@幒@@@@`, `$,2@ ē* h 2*  @``$*@?? * ( 2` 0 ? * *3 @ @ 2 @ İh2* @`$* " 㿐D@  ` 2 ``Б2  T @ "<"<# `   h ? P ( ` *@ 0  @ ( `$  2  ? <"<# ?( *@0  @ ( `$  2  2 `<`<#`#\a@6? " * &``Г0 h 2*   $  `  T* @" :@         *` <`<a@aX?&㿈 Ğ' D'H`'P3`ܲ@`h H6@(@ ``($.@.H ܸ `h@6@( ``  $.@(..H`  H1?ܢ 'a+`' a6@H'`h#``"a@'?%? * 6`$. '@#@ T`'@ ?6(. 6`0@ &? ?2 2/@((`@6 @6`?. 0@((`@0@0 0   * 4 @ ?$@ (@ 0@@   #8/`&$0` @`,'?0 ?@` @@  ۺ/@ & $@4(@0(( $ 3?c5?@. @(`0P0`.`(60P@@0(( $ 6 H/ غ`h0(``$(P  3?c5?. .06(.`60@0(( $  5H, ظ`h0(P `` $(3?c5?@. @(`00`(.`60@@0(( $ 㿘 ̥.`.  D  `$ Ē@ ``<`8@.@ `, % `2 %  ̀%   @ ,  $  *. " ` ?# ?*  *@2@ 2@ %  `?# @2 *`@ 5  `?# @2 *`@ 5 `?# ?*  *@2@ 2@ % `(?# ?*  *@2@ 2@ % `,?# ?*  *@2@ 2@ % `0?# ?*  *@2@ 2@ % `T?# ?*  *@2@ 2@ % Ā`X?# ?*  *@2@ 2@ % Ȁ`\?# ?*  *@2@ 2@ % ̀``?# ?*  *@2@ 2@ % Ѐ`d?# ?*  *@2@ 2@ % Ԁ`h?# ?*  *@2@ 2@ % ؀`l?# ?*  *@2@ 2@ % ܀`p?# ?*  *@2@ 2@ %  .   ̑, @  * ̐?$@<<bx@k㿘.` @  Ā?a D  `H  `$!@ <<b@0O `?# ?*  *@2@ 2@ #`( `?# ?*  *@2@ 2@ #`, `?# ?*  *@2@ 2@ #`0@+ߒ ` .` `,  "`d`  , ?&㿘 D H@ <<b e`.` ?  <<b @! 0U&  O!   И  *@2  *@     ?" " & $& !  6!@ !?*   ` ?"#@& Вה  Ё㿘  'Hh    ? Ĥ @ @ @ܐ  2 T< \G#P  "@ B > D@-   ?`$# @ `  @2 *`@ $   @      @ > D& T?#`$ `  `  @2 *`@   < ?  #@ `  ?  B`> Yw  2 *@ @ /D  `  @2 *`@  `   ?* +  2` 3   H@ *`D2b T ` 2 *@   B> `,:  4   ` `  p` ,:  4  8  㿈`h Ȁ  ?# @2 *`@ <i#  ?# 2 *@ `<Y# ?# 2 *@   ?# @2 *`@  ? `0  ?`<2# ?# 2 *@ $`h&`  <#耦` ?# ?*  *@2@ 2@ DH@n< `9 ?# ?*  *@2@ 2@  ?# @2 *`@   ?# @2 *`@ `,<`#d#h#\#` @Ϛ`?`     ,: `@C  ??`<`@  08` `( 0 `T  ` 'P:   h` 1?"<   <<`x@#? *`*h2 < `   ` !!`2 `$"* `4"`$  ,P  Ԗ?@?倊@"`  4`  ` 4 "t @  'p "t@8` @" p` p  @Bpp`   p` 2 p` j "w?v``$ D;@  @g@@ pp  L "Y?X`$?p&@m p  @2 `$» ( "`$`$@p-x" p     @Bxx  @`  9 @` " `"? ?` ` ]  x @A @` ` @`"?א ?`,8$,`$@<\?4<\"@P$8$4;  㿐  h`D `Ā  $<<`@0{V $<<`@0q `  @ ,` !H@ݑఀ <<`@@ސ@  '`0!,`I #0?`` $ ?# ?*  *@2@ 2@ @"U@<<a@0<\`"@?# ?*  *@2@ 2@ $  "<  `?Q5̚ h 2* ``$* :   <<`@@Ր* *+ `*"`` ?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`$ `?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`%|`H5 x*-  *`  ` ?? @ * @ +` 2` 3`   * * @ 3 @ 2 @`|`x5* - *` d"` ?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @$ `?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @%|`5x* - *` ?? @ * @ +` 2` 3` ? * * @ 3 @ 2 @|x5* - *`" @& @& `   @&ؔ@& ,``0!,`HX #p'D'H 'LV $ L?!"@ DL?"hD $'& h&   ɯ ,? L!#D@Z`|xH4 'ԕ* , *`  ?# ?*  *@2@ 2@ 0a'H 0 ('?Ԟ#?? :$ |4 x*, @ *`    * * 2`  2  7+  D@  ?Ԩ#??  : |4 x*, *`    * * 2`  2      v o'` $' ?# ?*  *@2@ 2@ @"U@<<ah@8? ' ̶?)'2 ' " +?)?@ @) @2`$* @ $@   R @ " 6 *  *@ 2  @ 2 @ `??% 2`2. * +  @ 2@ 2@ . @?   2  ` * +  2`  2   2  ` @ `  ) "@ ?܏)# 1'?+?)?@ 8) 2`$*# $@@   S # " 6 *  *@ 2 @ @ 2 @ `??% 2`2. * +  @ 2@ 2@ . @?   2  ` * +  2`  2   2  ` @ `  ) "@ <<ahx@E̓4`h 2* @ ``$* @ : "  <<ah@,* *@ 쀥 ?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @쀥"` ?? @ * @ +` 2` 3` ? * *@ 3 @ 2 @"|x4 ԕ*,  *`  ?? @ * @ +` 2` 3` ? * *3 @ @ 2 @|<ԑ4* @xH, *` j"쀥`?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`쀥"?? @ * @ +` 2` 3`   * *@ 3 @ 2 @`# |ԑ4x* , @*` ?? @ * @ +` 2` 3`   * * @ 3 @ 2 @`|x4ԑ* , *`" @# @#    @#@# ,H 6 $6 "& h6  6 &D`"$`(< @ @ 6 (@0& & <& @<\"@D& 4& 8& 0 &&  (& & &!& d 2ؒ!,E5 #L #ؒ! #E+, 㿘 h`D    @ l@ *@ @ `<<a@Z  * @ 6 >@ *  @?#?*  . @2@ 6 @ ! @@;  +&@ @ 64 >@ @: *  @?#?*  . @2@ 6 @ l * >@    ! ` @ ` @  l6 $* @ &@  +@ 6R  >@ *  : *  @?#?*  . @2@ 6 @ l * >@   "ڰ ! `@ `   >@   l3@ $* @?# ?*  *@2@ 2@  @@9  ! &@  >@*@ @:@ *`  ?#?*  . @2@ 6 @ l * >@   " ! `@ -`   >@   l3@ $* @?# ?*  *@2@ 2@  @@ Z ! `@ `   >@   l3@ $* @?# ?*  *@2@ 2@  @@ , ! ` @ ` @  l6 $* @?# ?*  *@2@ 2@  @ ! 㿘`hDl'L6@- Ħ@ @ `?# ?*  *@2@ 2@ &a@$? @ @`?# ?*  *@2@ 2@ Ҁ π`Eˀ`?倦'@x#@8l 2@L  <  l6; `*  @`@?# ?*  *@2@ 2@T# 莚 "taa``?# ?*  *@2@ 2@ T &@9 $ `&@?# ?*  *@2@ 2@   T?* ``@?# ?*  *@2@ 2@ T &@7 2" `?# ?*  *@2@ 2@ $`"" a` ` <\`hb@$`8 ` "`@֐` p㿘 hD l 6Ĵ \'H  H  @:eHH`   H`  H`ΰ N ʰ -` $  @?# ?*  *@2@ 2@ `#H!  @ \@@?# ?*  *@2@ 2@ @ Ҁ΀ Hx :  H "??%` TH`$??# ?*  *@2@ 2@  T@@ H @  . ] H@?# ?*  *@2@ 2@ H ? @  H` @j2  h; `( " hw h "       @9HH` <\Đ <\"@ % 8H 㿐 h?D&  `    l * @ <<a@{d ?& l * @   ՘ S $@ @ 6@   6@   TĔ9  ( @ &@ 6@ ( &@   6@*@ @ T  6@  #\  6@ *@ @ T  6@  #\  @ #\㿐 '    @8` "    ??& 㿘 h D  `@`H @ `<< a@ڔ0Ր @*@` @"`<* @`8`0 @@aa   Β@ 2 a<< a@0@ $* @  @?# 2 *@ 6 "  `?# @2 *`@  6 $<< a@!8 `  @ `t?# ?*  *@2@ 2@ `p   `?# @2 *`@ 6 & & @ `x?# ?*  *@2@ 2@ `t   `?# @2 *`@  ?6 ( & 6 & 86 ( !`  !?*(  2 (+04 0      @   >   & ,?& , `?# ?*  *@2@ 2@ & 0 ` ?# ?*  *@2@ 2@ & 8 `?# ?*  *@2@ 2@ & 4 `h?# ?*  *@2@ 2@<!0& @& <`"!0& D `d?# ?*  *@2@ 2@ & 耥 `l?# ?*  *@2@ 2@ & 쀥 `p?# ?*  *@2@ 2@ & `|?# ?*  *@2@ 2@ & `P ,  @ҿ? "<  &!2 @ `(?# ?*  *@2@ 2@ 6 *  `(    #     @ + ;( @ " "$ "<  @ & d<!X$& d@(< & d@<!& d@<!& d@<!$& d@i㿐 h D  @H @  <<a( @>@ @6<* @80 @@*    ' <<a@ Ű?0@ * $` " @?# 2 *@ 4@`  $?# @2 *`@ 4` & :` ?c4`c 2 *@ `4` @2N (`?# ?*  *@2@ 21@/ `?# ?*  *@2@ 2,@*   &?# 2 *@ `4` @2 (`?# * *@  $`t`?# * *@ $`p ( 8 ?2` 2 *@ 4`@2N ,`?# ?*  *@2@ 21@/ `?# ?*  *@2@ 2,@* *`` 2 ?# 2 *@ 4`@2 ,`?# * *@  $`x`?# * *@ $`t ,` :" ?  !?*(  2  +(04 3      @   <`` 0?# ?*  *@2@ 2@ $`$`` 8?# ?*  *@2@ 2@ $` $`$` 4?# ?*  *@2@ 2@ $`$`` @?# ?*  *@2@ 2@ $`h` ?# ?*  *@2@ 2@ $`d` ?# ?*  *@2@ 2@ @&$`l` ?# ?*  *@2@ 2@ $`p` ?# ?*  *@2@ 2@ $`| "< @ @2 @ *`2`*  `  ?# @* *`@ $`(   `(   `" ` V $`( * ``;( V $ @ӣ   @ۈ `Z `( ` `   @4Ɣ`    㿘 㿘 㿘 2 hꓐ h   2  2  @`& ,@ݐАP'P& h'HĐ@B  , ؀@  ,`` &` 2`-`$```4  ,  ,,@  ,  ;<` `` @4L `` ?$@*  2  < h@ ؒbX  " ]  "  $ S  ,N?#6 2 `  @2 *`@    H  @֒`? bX M .` "```.`PI"`  @2 *`@ 1 ,  " ̐ ` ,*    @`` ?$@*   &  2 ,-`" ` , \` .` ``.` 㿐 h`D`-?`@  !  ?# ?*  *@2@ 2@ u  ?Y癐 㿘?' D'@U $ @ h``;`D , 5  G 0  $? ?'  $" C<` b<<b@ ؖ` " `, `4  ! "d  ,! 2 $?'Z "" 4   4 ,  `% ,< $<"  ? '.   ?# @2 *`@      @c`?  ? 'Ȑ ?# ?*  + @2@ 3 @ ` -?# 2 *@ -2`) 2`?# 2 *@ `   ?# @2 *`@  ?  0  ? ?# ?*  + @2@ 3 @ Y`2   ?# @2 *`@  ? ?# 2 *@ `  ?# @2 *`@  ? "?# @2 *`@ `3   ?# @2 *`@   ?  !?# @2 *`@ 4  `$?#2 .@4 , @& <\b@ % 4 % 8<a0  "a0% D @ؠ2 '@q  ( "'@'@'?# 2 *@ * 2  ?# 2 *@ * 2 㿘 h?`Ħ#$  T<"ȒϘ J?#` `  @2 *`@ `` @2 *`@ ` @2 *`@ 5 &@'   2 *@ @ ` 2 *@ `  @2 *`@ 2?㿈 h?`Ȣ`Ĕ', < !X$ d`4 "=`@`Dݖ ' $ ?`4 $,􀤠 ?# ?*  *@2@ 2@ " "7< @@* (@"( 40@$ #*@ *@ 0 @  *@2*  * * *****<a0  "a0& D@א2  h a `( " h  h "       @0Ĕ`  쀢 "ߒ 㿈 h Ħ  Ȓ?'y <   4 &@ 4 "$ d<!X$ d@<!$ d@<!$$ d@<< 2 4 * 2`@d`@`D '쀤` ?# ?*  *@2@ 2@ " "7< @@* (@"( 40@$ #*@ *@ 0 @  *@2*  * * *****<a0  "a0& D@Þ2  h  `( " hϐ  h "       @/`  쀢 "''  $ ?`4 $͐锐㿈 hV $ `Ȕ?`Ā@#'?'  < Ē"$ d$ ,   2`  $ ?4 $`垐e2 $ @$ '?# ?*  *@2@ 2@  " "<< @@+ (@"* 40@&(* @#* @ 0 @ * @ **  * * ** ** `  !2  *` ,<2 b 2 3 +    @'?# ?*  *@2@ 2@ `"< "< @@+ (@"* 40@&(* @#* @ 0 @ * @ **  * * ** ** 4!` 2` "2  *`<" "2 * 4 $ @u F ( "pp`8 # 4 " "$4 " 2`@䒐`@`D2 '쀤 ?# ?*  *@2@ 2@ `" "7< @@* (@"( 40@$ #*@ *@ 0 @  *@2*  * * *****<a0  "a0& D@2  h ’ `( " h  h "       @.%` " $J  $  `6 $>쀢 "f'b' 4 $X 㿐 h ,   Ė   2 `$ < h<b@Ѱ  ?# @2 *`@ ?# ?*  *@2@ 2@  @2$ @?# ?*  *@2@ 2@ <"@ 2  <"@`   < h<b@0  ?# @2 *`@  `?# 2 *@  @ ?# 2 *@  ,\@?#-<`" `$   `" h 4  ] 2 `$< h@ 5q 0  ?*  *@2@ 2@ `# 7  2 *@ @ 2 *@  , ``  㿐 h Ĥ?`@`D x'`?`?# ?*  *@2@ 2@  @a [?,<0`"0 N& D  @Ӑ2  hb `( " h  h "       @,Ŕ` "T $ T $<< hc`@pa0  $a0$ D`4 $$ ,⛐ $<\?6 $@& 4& 8$ 8 ⍐\ 㿐 h Ģ?`@`D p'`?􀤠?# ?*  *@2@ 2@ [T $   h<<c@m  4 $ G<a0  "a0& D@2  h Ғ `( " h   h "       @,5` <\Z <\"@ & 8`& 4 $ ?`4 $ 8$ 8ڢ   㿈 h?Ĕ' '(  (<!a$`d4`" ?  N  `@ N `  ٖ 2 `$`?`4`$ʐ呐 $  N*  ?N * @j ; ( w"`` $`,ᔐ`@`D4 '쀥``?# ?*  *@2@ 2@<!0 `""!0& D@.2  h  `( " h:  h "       @+b`  쀢 "O}P'㿈 < h  " 2V $j? @$@c?D̘ 'Y  ?# ?*  *@2@ 2@<!0 `""!0&`D@Ğ2 `h  `( "`hА `h "`  `    @*`  쀢 " $ $<\ 6 $@ & 8ѐ `&  㿀 h Ĥ `@`D''C'`?'쀢 P'`?# ?*  *@2@ 2@  @;@  D '䀦`2 "' "<  2A䀦`?' ?'  }줒 `$  ?# @2 *`@ ` ?# ?*  *@2@ 2@  @?ဦ`'V$ @怤䀢  D@'䀢 <a0  "a0&D` ?# ?*  *@2@ 2@ "@7<\k0``$0 & D`$?6`$@` &`8@ & 8 & 4M`$  ?# @2 *`@ `?# ?*  *@2@ 2@ #@  @Р2  $q ( " $ $ ?`6 $͐`" $`$`?` 6`$  `6$߹  @r2  hD `( " h  h "       @)` ̐   @J2 h `( "hW h "      @)` "' '쀤l耢 "f䀢 `㿘 D'P'T'X $  < *`ѐ @    . & <#@fP! ``" `"  0` `"  0!<#В> !<z#@#㿘 D'P'T'X $  < *`ѐ @{  . <#@+P `2.  !<`  P& @v㿘#<cP'P'T'X@ !<; H@a㿘 < `p@Ӓ = <. `x@ O<@< 8&@`@ <@ ~&@`@ <@ @t&@`@ <@ j&@`@ <@ `&@`@ <@!V&@`@ <@"L&@`@w <@$B&@< В`@j 24<@< ?&@a@` <@ +&@a@V <@ !&@a@L <@ &@a@B  <<?͐! @` &@!`!?° 0  `p@ d 㿘 DP Đ@ @Ñ?   :%HTLP@"%@ @ ߖ x@l H4* "@@FT H *  a& H     ̓," H * ̤ ? " "  H 3?@#bU @ഠ<8@ג, ,   ̕, ,"@  ̀ `$  ?*  *@2@ 2@ H*  ?     $$ 6!+ " 4 ̀ !H   ̑,@ "HH    , , 㿘 D P@ʐ? H@$T@LP@a% @ @y@ ڒ @  @ T@@ @! @` Вv,` Ѣ`!@ `8 H Г,` Ţ``,`H @ ̑,`@ "HH`@*  㿈      .   ! &!`& ! 2!<!'2 ! <>k!!`&!! ђ & D`j 0! ' "J< " 2<u#P @$o<""W<!C<g#P$$a<> &%``%`ha0< (%``%`h b@< (%``%`h`@%`P%`tK%a <$ (%``%`h%`P%`t%a  2? <0"$ (%``%`h%`P%`t%a  20 <!"8( (%``%`h%`P%`t%a  2  <" $(%``%`h%`P%`t%a  `!0<# = `& #P=ܬ 0倦 ɒ @a @ T Ր$`h: * `@":  $*@ ```8 d$ b\F $*` !T  @! ! ' !" <a 8<@ qa  %a =#h` 0?# ?*  *@2@ 2@ %`L` 4?# ?*  *@2@ 2@ %`P` h?# ?*  *@2@ 2@ %`t` L?# ?*  *@2@ 2@ %``` T?# ?*  *@2@ 2@ `L@ %`h@<=.#7`P" dh<=!#*@`t" @ `P;`t!@`=bd2T<b"8 d" H`? H`?# ?*  *@2@ 2@ ` ?# ?*  *@2@ 2@  !8" <L р   ? *` < *` 4< #<  <:`< 8  h< `&  4`?# ?*  *@2@ 2@ & ` T?# ?*  *@2@ 2@ <!. & & `\?# ?*  *@2@ 2@ & $` ?# ?*  *@2@ 2@ %`(` ?# ?*  *@2@ 2@ %`,` ?# ?*  *@2@ 2@ %`0` ?# ?*  *@2@ 2@ %`4` ?# ?*  *@2@ 2@ %`8` ?# ?*  *@2@ 2@ %`<` $?# ?*  *@2@ 2@ %`@` (?# ?*  *@2@ 2@ %`D` ,?# ?*  *@2@ 2@ %`H` 8?# ?*  *@2@ 2@ %`T` <?# ?*  *@2@ 2@ %`X` H?# ?*  *@2@ 2@ %`\` L?# ?*  *@2@ 2@ %``` P?# ?*  *@2@ 2@ %`d` T?# ?*  *@2@ 2@ %`h` `?# ?*  *@2@ 2@ %`l` d?# ?*  *@2@ 2@ %`p` l?# ?*  *@2@ 2@ %`x` p?# ?*  *@2@ 2@ %`|` t?# ?*  *@2@ 2@ %`` x?# ?*  *@2@ 2@ %`` |?# ?*  *@2@ 2@ d%``8 ` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %`` ?# ?*  *@2@ 2@ %``!X?# ?*  *@2@ 2@ %``$?# ?*  *@2@ 2@ b %`a`d`<@ '<'@8'<'`!?  !?*(  2  +(04 3      @   b =`a`d`DH 'D'H@'D'耦`!?  !?*(  2  +(04 3      @   =`Ȁ`L?# ?*  *@2@ 2@ %`Ѐ`P?# ?*  *@2@ 2@ %`Ԁ`T?# ?*  *@2@ 2@ %`؀`X?# ?*  *@2@ 2@ `d `l+``h `P*@ `(`*`T2*@ *@???%`%`%`%a%a%a%a%`%`%a%`%`%a%`%`& & Đ, ƒ  `& ,N  !. ) #0`@ʐ`"6  6 !. ) # 㿘 D$h:@*` ``$8$ $ @ Āp <\`"@?# ?*  *@2@ 2@ '" $V`?# ?*  *@2@ 2@  !8" " !+0;$07`?# ?*  *@2@ 2@ %#8`?# ?*  *@2@ 2@  `?# ?*  *@2@ 2@ #H@N . 㿘  Dh@,p D6 㿐 D$`h`: *  `$```$8 !  ȴ  Ĩ ' ?ꒊ'@<8, ?'&!@ ` @`v@,<\ "@?# ?*  *@2@ 2@ "$ $V ?# ?*  *@2@ 2@  !8" " !+0;$07 ??# *  *@2@ 2@ %%!8 ??# *  *@2@ 2@ $ ??# *  *@2@ 2@ %!H@  .   <7   2 <7  ?&  X DF`!T`$  ?`D'?# ?*  , @2@ 4 @?# ?*  *@2@ 2@ `l d+'@@`X  d@@`X"@ '`@`H'̀?# ?*  *@2@ 2@  'Ѐ 'D;@ @Ļ  ?㿐  @    擖 2`$\? 3Ӕ`㿐  h     @   m 2 `$ . ,   J    J 2  D;@  @[  2?`?㿈 h `D `'P , @?l !*@    - ''   l74''_l5*  ?# ?*  , @2@ 4 @`2 <<a Ԑ  )?#`@P    @ ?*  *@2@ 2@ @֐  " א  *`$ @, "@& @Ԯ@< m;?* ?c ?*  , @2@ 4 @`OT :2%@c`@P    @ ?* * 2` 2  @   )'l & "Tv T *`%@ @ " & @M" T$@TT **cl7*  ?# ?*  , @2@ 4 @`2 <<a0  0?#`@ P    @ ?*  *@2@ 2@ @   E' B "   *`%@ @- "@& @Ӑb㿐 hĮ D ` ?# ?*  *@2@ 2@ 2L% @}`'?# ?*  *@2@ 2@ @۰ 0 2 ,' L?@@"  @w 5?h`6@ P*` 2 ?$@* @@?c ?*  *@2@ 2@ O`T @:0$eP `  `  ?* * 2` 2   * 8 '"TC T`@*$@   $T̐T @ " & @ 䀦@*h Ƿ @*P?h2 ?'?#?6@* @$*``  * +  2`  2  @`@ 6@@*+ h@ `# ?# ?*  *@2@ 2@ ' @ " & @ҮTb@' h "    " @   @;@K@Ӱ㿐 h D L ,?@ @@"  ?# ?*  *@2@ 2@ `2Lɰ  @+'?# ?*  *@2@ 2@ @@ 0 2& 2?#h4 P*` 2 ?$ * @ @ ?*  *@2@ 2@ `  , @ F@   Ԛ *P?h2 ??3? 4*  $*`  * +  2`  2     4 *+ h@ # ?# ?*  *@2@ 2@ & @ " & @ѸTl@' h "    " @   @E@U@ݰ㿐 h D ,`L?@```   Ē@`` " @"   ؀  ?# ?*  *@2@ 2@ 2`L @-@ '?# ?*  *@2@ 2@ @ 0 2`%@ @ :!``h`?3@* ``P@2` @ $, * `  @ `@ *`h` @*`P?`h2 ??'?3@*  @$*`   * +  2`  2  @`@ 3@@*+ h@  # @?# ?*  *@2@ 2@ %@ @a " & @ɐ`T}@' h "    " @   @V@f@㿐 h< D  " (e #a Т )<\ "  2   ܐ!!F ` ِ2 h ,h@$:@ b ""@P $"@@*  @  (   ""@I"@& 4& 8P ,  @? `&!1㿘`7 h62 (x  "-  &&  .`P=6`,  $  *P  ,   "@0  . @   .  㿘 `23  h6`8-  &&  .` P6`,  $  * P  ,   "@0  . @   .  㿘   ,  @ "    , xJ㿘   @  "$$ `@  㿘   @ ,`  @<2    ( " I `@ ,`㿘     , @    , 㿘  ,  @Y , 㿘    , @ `" p   ,       *` 8`@ **` 㿘    , @ " !   ,         *``@ 0  㿘 h*@ 8   P8,``$@ P@ 㿘` h*@ 8  ` P8,`@$`@ P 㿈  `h   D "`<`aH ƀ 4  >  `<aP ƀ ' < >  , ?)< @ ?!X@@ƀ   < >    "  hD (  `?㿘 h< Db`D&`P  &``@ `02`D  `D`.`@ ϐ '*: ?ЖJ?Ѐ` +  * @@  `+ ` @`&`` "``P 㿘 D  @: %< ,`@ "  `/ $6 $ `@*   "@   D "`v v㿐    ! ` <Za@ݐ '*@ '<a@Đ <`"S J@ = @ J@ 2F 4 a@ <`": J@ $ @˔ J@ 2-  @a % `!J@  @ J@ < <a @  =/6`&` &`6`6` 㿘    .  ! ,`2e $uT  {v!!$@$`$uJ  $` un`@*`<$  ђb& $& . & & D& , 0!. m #ޒ w  , 6?D <.!3 , E  ". ː. < !& ,`$``D`"`$` #"?!6. 0& 0!. / #0Ɛ0к06 0<.s!ؐа6 u 6  0!.  #6  X ђ$ ?'''''̀ 'D;@ @ْ  ?`h<\D$"`d2`"2`$"`,@`"`4"`<"`8"`0"`@2`( 2`&<" 2`$2`" "`d<"`d2`"2`*㿘<"(. D `2  )  "  "  2&  " 2( $@  2"2$2* " 2D㿘<" .  D "  "$ 2$  2 D ? ? ?4 ?L ?` ?x ? ? ? @ ? @ @< @P @l @ @㿘?" D; @> ? 㿘D;D   ? 4?ꀢ  @  ?&㿘 C t6  *   * *# t`  " ,? $ t6  *   * *# t`  " ?`.  $`t<`0"     < $ 4 $ $㿘t    . @   $ 2 ?&@  ` ? ` `2 ?&@ <- "& 㿘L 0! *2" 2&2(& "<l&  "ࠒ`& & & & "l ?㿘  &    €  <,Ӑ"(<cl?"cl  & 㿀 @''`` ' @є ` <쀢`@㿀@   @@ &`  " 2`쀢 ` &`쀢 @0 ?c  @/쀢 @l??p ?2    $`2'''  @'''''аp ?2   $2` `@ ''''А '''''dذx''''''$2  @` 'P0t؁㿘  `$㿘 `` 㿘  @ ? 0<+"X 㿘   rU  2`;?`  ` ``0@```` 2``"` s  "" "" " $ " `" sy   0 @Ԟ @㿘 "$?  `?"  ``"  "   @2   @*@&  N  x<]*#   <bx@ NC (?р  ```` ?ꀦ?Q 24 <+R"? & ^㿐 `  t    . @" A㿐 ='?'ג 2ے *֐ ``€ 'D; ?&  'D ?&'s q` t x  't  'tO t㿐    (€'> zt B?'t ; 6   5't   $ +'t`$'tt    *@`&  x p  p|tȐ?Ȗ t0,t x  't   `$'t tt x  p 'tp't tt x  p  'tpq't tؒL # P'P?`'T'X'h'l  '\x< 'L'X  $@ 2@'p#X'Lq L㿘 Ϛ L '  P'''''''' `$ 2@Ѐ  'L  Ԑ &'L8 L㿘 ˚ 㿐 ?f "?#@2  @ ' 0@'  㿐E "?#@2  @ ' 4@' 㿐$    ,€' 㾐8?D;@  '@ @Ȕ    2[ T?ꀢdN'?'` *``@X  Bx@ E 4' ?ɀ /' `@A  &@?'D @@ ''` $@ @'"'`@<@`@6d`㾰?D;@ @ '@X    2T M?ꀢdG'?'` *` @  ; `@Ҕ *''  $@ @  '  '&`` '"&``''@ @͔ 㿘 `   `?`8?㿀? <?#p  D;@  @ؒ ?{?`u< *` €  k S e ƒ _ b Z m T ђ N  H  A   :  2  J+  #    @  ^     ?㿘`<<]#*`"  "' ?Ɂ <]*   ?㿘<#l<c(@S&@ &&@㿘,?1<# @<+p`4 "&@$&@ # @| 㿘?0/c  @j% 1<# @q<+p  "c @F?㿘< p.  <  "  2 <#.  㿘< p.  <  "  2 <#.  㿘< p.  <  "  2 <#.  G@_@i@l@}@㿀 , xP M?D;D    ? < @ " "v "c "-("9?0'I?0$"t l?0>?0 8?0 jR?0`;<``&?0?֐`?\@ !! `2, }?, }, .,"b, {ذ<#Ȁ8+ (*($ l"@ɰ#̀8+ !*!$ 4 @aK, w, v, z\@ !! `?$"\h @y    ? , x , x$ , |\@ !! ``t?>$ 4  D @E _? 0 @ < @4( @Þ @O@O $ @ z 2 46?$ 0?D? @    !@ "p?$"p `*   @  @ m 㿐D;  D    ?  ?y" n" "=?0GH?0"8 b Z?02@n?0`".l4`V@?0W U?0"&` ``?0x@=?0q }N'L' {1* G'4D' .A' w&* <'P @3V4'T @3N-' v*  z* \$' x * : '' |* : ' '' ''   ` d @ 4 `  D@  "D ??'`? 㿘<`i "6 ,@#6 ,㿘#`""p@"p `*   @~  @y2&"pl&"p ``<$I#p<`j㿘  x P@`"@㿘  x`@@T㿘 P l@ @ǒ   P x@-<"& & <^``$ "`$ 㿘' P l@ ?'@   P' x@ <"& & <^``$ "`$ 㿘 @ 4@ @   @ x@<#& & <^``$ "`$ 㿘< `cؐ  `@Ξj&  @՞<^``$ "`$ 㿘kh `@Ğ   @ 4, 㿐"''*@" 8H`@ "'"@  ! P l@  "P !H` `2"`㿘"P @12(' #?    h "?  " >ג' 㿘 %# !<X `"    ` $ @"``"@"`# "#€ @2 `?$`<X   "     2` "  <X "` " 㿘@ 㿘 `DȒ `D @˞@ H``D@    ?& "`&`D"""ۂp`P  <`@  <`t < 0 !@<b&b" a&b&b&b؁㿘`<] ,c* @ "c ?Ӂ?Ӂ?Ӂ?Ӂ?Ӂ ?Ӂ?Ӂ?Ӂ?Ӂ?Ӏ` `2?d "" ` "" \  ! 2" ?  ?Ӂ?ӝ㿘 t  8’ !㿘 t  8 !"a 㿘 t  8 !"T 㿘 t  P l*   8 !   l P@, g  "1 㿘"t h  D # D  T # T  # <Ԇ < c#  + (  # h# 4# l+ )#"#"Ѐ #"  3"`# 8" <<<<<?p̐ c#"l#"#"#"#"###"d#"h㿘 < \# <# 㿘 < \#ؖ <#r 㿘<#<!n <<!i 0<<!d `<<!_ 㿘<X`<X ` <c  "c< !H#<`fy $  ?g  <c @F<c& x @? & & |& & & \. e. f& p "`f<c @* 㿘 f    @02<h$ |<`fؒ<c @!㿘  <   (`` @ `"& @& . g. h&& & & & . i6 v& (&  ,@! 0& l㿘<`f * @m   @ў <. fc @ɞ<c @Þ`(`` @ .`e&`p.`f&`&@&`&` &`㿘  |;" 2 |P  `"@ `  &`&` \`\ `| `"@ &`\ &`<  | `|@"  `&`&``&`  &` l&`l t6`t (   @t&`( `,@&`  ,&`  $ 0@&`$ d .`d&`p.`e g.`g &` &`&` v6`v &`㿘` `|`x" ܐ" 2 J  $ $ `\ \ `@  " $ \ $ < p` @`\$ $ `l$ l`t4 t`$ `(   @$ (` ,@$ ` `,$ `$ 0@$ $ `d , d$ p, e `g, g`$ `$ $ `v4 v`$ 㿘& . g. h&& & & & . i6 v& (&  ,@# 0& l㿘 ` 2 $  )$$ ?*  D;   @E ?ؐ  $   `@ `@ `㿘$?#;  8  D @ @  @ "@& &&  㿘  8@ @"@& && 㿘#?#;`   @D @@Ҕ  &@`@"&@&`` 㿘` ?&``:&$ #;`@"@   D @@ &` 㿐`  '&``:&"'-;`@"@ ;  "` D @g  j``&@ؔ^'  D @L  O&@’ $& ```$@D @ @- 1`"&@D;  D  ? ? ?'@Β @D#@'  @&`2}`'?'㿐bP @,2&`D`D@dbP @,2&` 2&b`?ǀ  ` `" `( 2& >}?`8''H`@ "'"@ !`D"  !H` `2"``DbP`H/``D"  p @  H``D@   ?$"`$`D&& &  "a`D0& 㿘 p @ў㿘 ?D;  @(@ " 㿘 @㿘``8`"bPbP  ``@"` `  `D`D@2 Ab`  ` ` `( " `(  `l`P@, g  "b! "㿘 ?2  @< 49?ꀣ 2 $c  2&@.?#*` @`$? @ +`&?t    *@  " 2  ?` #@㿘 & ? .  w@ ?. d㿘` { y` ?``$ ? #@2_    0y tPn @e `@\@ !! `5?@"@" @"\  !! `?@ @ @ \ @ !! ` ? %`  ?`" @ 8  2 `" `@ 2`cy & `"@?   Q㿈`  `` @`  3$`:'`  $`'''D;  ?@     D @ @  ` ?` "@$`$` 㿘`      ` 2 &  +;(  ?$ 3`t * ` * *# t` @ " @+`   " t @``"  y 6D 6-  D @;@ ?#$ ? D @;@  $ ?  D;  ?$     @ " & &   & 㿘 $ a  @$  *`  "`  x x x y u v x x yp yp yp yp u yp yp yp yp yp yp yp u v yt yp yp yp yp yp u w@ yp yp wt yp yp yp v v yp yp w yp yp yp u w yp yp x yp yp yp v4 v yp yp yp yp yp yp v w, yp yp xd yp yp yp vp w yp yp xp yp yp yp vh wT yp yp x| yp yp yp v\ yp yp yp yp yp yp yp vT yp yp yp x x yp yp v yp yp yp yp yp yp yp v| yp yp yp yp yp yp yp v yp yp yp yp yp yp yp v yp yp yp xT x\ yp yp v yp yp x yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp yp x ?  ? $  |@*  @   X    \ , @`@<"T*` €ް&۰&@ Ӱ`Ӑ`͐@H ưð..66 8) ) :# # "  2  8  :  "  "  }``v y pa"p^ q j``c f pN"pK ^ W@`Q Op<"p9 GE CAĒ@Ԓ@@@:9 0* .,* '@* "@ !* "@* "@ " g   0  0  t  4 ,   3*`22  )? 6$?  6?( 뀠a4`6?? Ԕ*` ?㿘  *`@`A?   2 8?`  D;   @ʐ `"? $ $   bp&bp `` *   @? @:`Ԑ p h | \ 8 @ P p \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \  <!<a"!""a<^l(" 㿘`2 `<!<"!"@0<^*` l@@  <@ "  <"H㿘<& ` " @{ 2 ( 2 <&`"  42(24 㿘<& ` . 2  X2  ( o h@ 2 ( 2 X 㿘 @   c$?㿘 ^*   ? &@& &@^̐ 㿘 P <! #    2㿘 @\@ !! `:V㿘 <`"p@<"s  p @p 㿘 P  ,  `@ 2# 2 P<!&  P`A@6 P@w<! "#  2  2㿘 P ;(8?@<a    !! 2 `@  <"@ P?c 6 P<a " #  2   2 < @$@@ ""@<᠀ @`  `?㿘, <!%%< @ $ $ @* @D  t@ $ ` " `Z@$   $ , g` ``` 2``  @  2 㿘    & $ \" @"& \&  (  . g . i<n"@㿘<X`  "`  `" P€ $`  @  <b&"b <!`z € ` ?$`@ <-#(` p?$` @I2 ' 㿘<  `7H`  #2`?"`""""`"p @ 0Հ 2<"!㿘  <+ <  <aD<!` <^ `P("`` @Ξ p @۞=09 Ph"! 2& H`& `` "`&& "`"<`D""`D< <^"!` @ p @㿘<@<bb  @-<  @1<a@" `H``@    @?""`%$@$`$``w``$$` `| $` <`#X0`t`p @O\`-X`! `t )<^ ``@2  B  `  2   l* @ ,2 2  ``@2    `  2  ``p @`֐``@j@<@<"!<`D""`D <*   ?xD; ؐ@3   ?耢 2?@D @@    ?㿐D; @    <&5? `  <! ,`@   % ``,` ( 2 'D@є    ? ``@` @`2`<<` `c@`#\`8#``,`(`0`4#d`T#h` #l` #p`#t`#x`#|`H#`$#`@`D`P `L@#`X@#0<@@c؁㿘<c@<&``@   $ ($@&&@㿐<^ <`#\  @y "4 & &@ '㿘 P x6 P & x?" @6 P* P2 @@ߐ P<a <!<!  㿘 P |6 P & |?! @6 P* P2 @@㿘 P?` #@ @@6 P  <<#"H@ 2 P@ P  < <! " R#  2 R  2 R! a? 6 R R" b? 6 R㿘 ??"@`^<#*` € R? P` #4` T`$` T` T@`ذ? Ԁ"$ T€  P <!`# @ ``2@0 h`@  X 4` 2`? X@?`€ <!`# @ ``2@0` X@?` `@Y <a #  2x   2r   $` $` 4` ,` =,` <d,` Ȁ€`\ X?` T o`@ N  J?` F o`@ @  4  :$`` 6?L$  P 0?`E "(?@ <*`! 6#  2   2 ?ݐ"@  ? Ā]x"a%a<^`   #<^&`   @% @/<^  #2DO~;@ ؐ@   "/l?@c : 2,?ݐ"``=<!$*` €C 2S :,D@@S   A??\@ !! `0?@ x@ %?ݐ" 8?@ g@ ٢`2D@@   ??㿘1<    & & s 2  㿘<!`<c! <&`` ``"N?@ # ( ( & (@$@ ,?` & 8@ <&5?<& `  `"-?@  (%? ( & (@  8?& 4& 8$@<! " #  2   2 㿘<!`''<& P ϐ@ <! #<%    2@ǐa d!a 2```@2 `(`("`0"`(€  `(`@?㿘 P   !<X  $  @ ?$ 㿘<X`  "` p  ? '$ $@ t Xc& t$ @   @ 2 2"   $ ??$㿘<X <X @`  Vܐ  $ p `   @t 2 2 "   '$   #$ 2 `?? $@`,`  p @ $@$` $` t& p & tj$  `?$WF 㿘<X `"  p`#< p& p  @apWҒ  p 2 p& t?$㿘<X` 'H'T"`  <& `4 p "-(3<@/<4@  @  @  )<  @@! `@ @@aȰ   24(2pT "@ '@?' H@ & " & 㿘<ߐ"<^` `䀢#< "  @$2䀢 < "$a ab ""<!@@ $a" 㿘 p @v 㿘 p @h 㿘` ` `@€ " U   @<a@<<!b0<& & @& Da& H&  @G`  @B㿘<X` "`   P  <^<<<%!b0|& @& D& <^#< a& &a"!<"><a@!< d d$a"$ ~?$㿘 < 8  & <  @ V  ,& 8 @2  H  2 H@L H ` @ H `<@<a @U㿘 p @ߞ?Ν㿘@#@w6 㿘` 3  '<*` @` $@ , 2  2 2  @ " (   $# ` @$` 2 ,`֑*`@$`|㿘 <l!?<X` "`    *` ` X`" "K$$  ?&  ,`@    v @ $  4 )< @]; H`@@  ` ?$`"`$@"""ۂp  ܐ ހ $ 0 @, , @| ``*`30  @ H`@   ?$"`$"""ۂp@" ?%㿘<!@  p@`&<  x@  t@$  |$@!(    2   x@%  T  2  @ 4"`& 4"`<< ܔ & & P. & & 0& & @& D& L < $ Ē`"㿘 @?4 4  4 4  ,   2  X@| , , 2 # @ X& `" @   "  `" @ 6  @  @L0<  @*`" & & ,,  $@ &"@ & 㿘 !T@?4`@4`@ 4`@ `,`  @" 2   2#  Sj  @ $  `" !T@ !TT  ,`@ $"@ 㿘 @2  2  2  * !T  @ߔ 2 2$@  Sڐ   ?㿘 *`!T`  `2$@ `@S@@ 2 `*`?㿘 `< , < ," 0X   " ( @ ( 4`%<< @`& ("@"`  @2 (S  (`2@ T  `@0  @vT H`@    ?$ "`$"""ۂpSG$ T (` " 0 T"` @`2 T T (` " 0 T"` @`2 T㿘 < !@`"    $# @  . А0    $# @   "  @ . ː㿘< !@`d& U 0X $ !0@   &  $ $  *` ` 7 2/   ,$  , 2  "    $ @ ( $@$ $ & @    $$ @ (@ , f@ 2 `Ñ*` l & 㿘 <!@< r"H0w   $#@ @  . N0j2  . .   0 4 8   J  . Ȑ " 4 €   4    @?$ "& 4"@"`"``2 T0  @T2 H`@    ?$ "`$"""ۂp0  @@ & H 4 4@ T €  . 㿘<X `"   `ڀ z ` 2@   2 ` `p @`f 84   3. . <!@ @@ G& H T`€  .  ` . `p @ڞ鸐`<   + `% 4  `,@  8$ """"`"p @2&`锐 &`  $  4&`&@"`& 4`    . <!@( @@ & H` ?$`㿘   2ذ?ހ 2 o    @ € ". 1. ` ހ  @[   ?  ? 2 %<@& @ ު&  @2   € 2  @N @@/.  o@ `Ѐ "!  (`" H/  H*/ @`  @*`" & W ̐``2M   4  8 2`0@   ހ  4@  ` ?&`"`& 4"""2(0  @ٞ跐 H`@@  ` ?&`"`&@"""ۂp 㿘` o       㿘 ( ` . 2 @   2 *  $Oʒ  + @ $4 $ $̐€  Pj  @Y ($  € & ( T  T $   @E&`<㿘   \"@ "  & & \  t    @  㿘 ( X< 8T<   \" "@& \& @ ڀ $  2O  `̀ " !<X < 2!<X'<X $ < 2` H `` t \  ?$  $ ` t \   ?$ ` pT@"h   8 p @ʞ2?稐?㿘 (!<X 8   \" `  "& \& $ ` t`  \  $ `T@  p @2?y?㿘<  !@@ 1  `"  @?$""""`" ` @ @p @l@J  @  @2` ha@@& 㿘<!@@@`@`D  p @=*0&@ &&A @ "&@& (`` @ &(&``"`&&"`m"㿘 LNS  ` @ L -&  & $ ܀ € "` N ` &&` 㿘` @  <@2 "@@ݐNҐ0@ 2@<"㿘<!@ 8& D & "  l< D @ d& & & <"(&  & & & " & "  D<*` * & && |"㿘!<X  $     %< @s H`@@  ` ?$`"`$@"""ۂpڒ   ?`$ <B"  2@ $@ 2@"@@S  㿘$PM  G<b$P@ɐ`8`0`4```(` `,`D`<`@`H$ $8$d$$$$$@$l$$Ā  $$ 4 ,@J$ `L`P`T`X$$H$t$⠐H$$\$H$$$$ ! $&` M?Ɂ㿘  & !M㿘<^`   #<^А`   @О㿘<^` @ٞ<^ \ #㿘@.` * "?  ?& $ <bd<* ( ( ((@"bd㿘<bd"bd㿘<!@<<a @p<"l"@ @"p"p<"hp 1<!" `"p<U#&! <a  "a㿘  \ |`& \& <仒 .2   6 6 `o@א `P`o @ђ`h`P `o@k `Z`o@’`Z`Z 㿘`` `@pG <  o`@ h 㿘 $ $ \`Z @"$ \$  $  ``@      `h@   , g % ? c   㿘 $`@r  㿘```  ?4` o`@c h o @_ 㿘`o @W㿘` ( @M0 @I "`ޒ쀢@4 `4  `"`"@Z . i& `㿘 `!76`t`  \7 㿘 K   <<!`H& & 66 㿘 M( 㿘 `@ <!` € 2`<!@? $`\`$?€0`(㿘<""@`,? $ `А & $`2 2@$$@@2`,㿘<"" #<  ,$ " a@ \ X" ( 2 ,a@<"a}" 㿘 p @  㿘u  p < P p @ސ 㿘 l< x ` * *  h @`  #  "## ""@`( &`(`< p &`< @Ҟ 㰐  h @   `"` "@"" "  ("(`   l<x* (h@#  "@# #""@`("`(㿘 h *` *  ` @d H`@    ?$ "`$"""ۂp`ґ*`& ( h " ""   㿘` hJ  @m "`& "`& ` & ` & ,& & `,` @ K( 㿘!<X   $ `0`@ ?$ 㿘   @!<X  $ `0`"`4@`4`@  ?`$ J㿘 <"@<X  <` 2 & < 0&<#& <X `"  <#@& !"`X !<!@<Xb" "\ؐ !@!& `?$`㿘!<X  $ < @ <""@ @  "@⠀@@2 @""@ ?$ <" " " 㿘!<X  $  <b& f&  < T!&  ?$ <H  2㿘  @ "&     \`& &   & \&   p @=2  㿘``\?`|`` &`\&`<ဒ `  * **  \  㿘   IR  <.  H<<c  6& 6 & & & # H㿘< HHH/    2 "Jz 㿘< `  @  2 㿘     ` \ &  &   & \& <`h `h2`h&  p @2  㿘``\?`|` &`\&`<L ` @  <`d 㿘   H   @ <`d 6& < `<<"a(6 & & & # `㿘< `HH/ @@   @1  2  $@Iے 㿘 `  \ 㿘 Ho   <<#a0& & 66 㿘 I < 4<<* "@ p" l<*`" h 0(" h 㿘`   ` @`?`  l* ** <a0@ Ȑ㿘 ?0?0   㿘  h㿘`<!@@ & $0 㿘`d!<"HkZ ` @v`d  @2 `@`<`@`0`6@ `4 @ ``0`6  <^ *`@@"#@#`"@`d  2 `8`<`8`0`2@ `4 @ ``0`2  <c*` `# #` "`" `<<``0! `4  *` `"#` "`" `d !#`d㿘d! " " " "@" "@d  >"d<" 㿘(0@<^(#./ 00 42 <@2 62 0@2  @2 d1 *0@( )*0 0@2 @2 62 <@" 4 d" 4  d" @0ް 㿘(@0<c(@#/ .00 <2@ 42@ 8@2@ 22 @ 02@ d"Y`@@2*`0(@%*0 02@ 8@2@ 22@ <" 4 d" @ 4"-` d2)`@@ `(@%*0 d"@ 02@ 8@2@ <"@ 4"@` @ 0@ 㿘./ 2g3  c 㿘./ 23  S 㿘  @  E h㿘< ܂ & h @̞ ` : \ @t $ d@<bĄ @ƞ0 0 "   " ? 2? <* b @@ ǐ   GF t<c̐?"cH<b?* 0H2b;H2bH(*2 x'X`'H^`  ` ? ?`?   ?F. 2D` ` ? <`?  <*`"@-@<bȐ  "b<` "` ? ``?   ` !<!<a@z< *` p   E_ t -!<<bȐ  _"b<` #` ? ``?   ` !<!<a@z< *` ǐ; #̐`$#@  t & & &&  & & & X< & ,& 8& <& & (6 06 26 4& d& X& \& `& `.`2 d<   / 2 #& d d`H & @ & d` ? ?`?   ?`"l@6 6<X` "`,XH4 {6`  d <& dbĄ @k<X`?"`@Yx "`<X`?"`` @d` ` ? ``?  ` !<!<a@yؐX< *` X6`6#`[#\#pY<Z#lH#dI#hJ#PK #t{ M9<,3!<X6 6  $ + X3 H 6 %@ 2 1" ?,$  @n ?$ @'"Ȃ  @ 0C"` ?$ ` @@ "Ȑ  &'" 0< # ? `?   ` !<!<a@yL< *` @ES t#̐?%#̰ 㿀  'H @ ` `* ?"@@ 2 8 ` ` 2 * @8?``$.?H 2" `  (`  ` `  4 @ǔ ``@s  'H`X`'H` @_ ` ```H?"?@& ", @ i  " ` $ @$@& @!% ` ` ,2 +`@` ` `@B* @ 2B8 *``" @ʰ? `*`@ @ ` ` ><#쀢`!`d  `@H"`d`<`@`A `B`CKI#dJ#\3#`ÐHZ&`@`d "`d`0 2 `d`d &`dI6`2`d " 6`4`&`< `  ` `H#\R#` "u?`T 2   `" @Ɛ  \$`@"$` `64`T`2 H@    @ \ * "@@2% `$@ % ` `  "4064 ` @y,2`,  ` `@B* @ 2B8 4 ` @b,2`,  ` `@B* @ 2B8 *`2``4<c4@'$ d 㿘  *      ``@& `6 4     * 2`8  `& `2 6@, 㿈'H   `*` " `` ``^? @ `+ @  `  < @ `*`   ` H#\#` "ְ?<#쀢`"" @ d " @ @H" @`< @ A X B CKI#dJ#\3#`H>& @ @@&$  6,4`2` 4`@*  2`B@8 4` ǐ  `  * 2 ? `` *  ` :  y@ @ ` `                +  ֐  U @@&;$  @ &` @n@&2 6,472` A +  2   *:?,2  @@@* @ 2B8 *``"@'?` ``  @@&$  @@&&` 6 4 @3 4`@*  2`B@8 4`  㿘@ f   @ @ R   @  p@2$@$@&@ * &㿐 ' * '"  ````V? @     `    `     ` * ` `d $`d ް?`8"`@%q,`22`2 2@*  2`B@8 2  ̰ 0 ` 2 * 2  ` *  ` >     *@   Z cC    ``8*`"@% `8@%$ `2`4  @K,2 2`@. *  2`B@8 2 i  2e ( 2   ]!@ *`2`@$,2  @  * @ 2B8 *`` < ` ` ? `  `0<`  2  &   `8, "`@$`8@$$ `2`4 @2 @͔ *  2`B@8  2 ` @Ԟ?㿐  ' g D  <%#|@>? * '   * "@*`2  2 8   2 * @ 8?"?` ` ``   Ḑ * 2   <"Ā`" ` 2 i  "0 @ i  "( @,2`"@@D @?$ ` , ` 2 * `` ` B* 2`B@8 *  " @? * @@`` ` .` " d ` $d44 $<`" dd $d44d  ސd $d q$<  y?8"`22T`2 @ ` ' * '  `*`" 2 $ `,2`"@@ $ `  0<2  ` @,2`,  `` @B* @ 2B8 "2 2  ` @,2`,  `` @B* @ 2B8 2 ` <2`@#U ° 0 㿀 \ "& \ << 8  9 : ; 2 =#\ >#` ?#d 4#hH#l@ & \`` @R㿀 \`2& \ 4< 8 !H`` `` 4< 8!#l < 9 : ; 2 =#\ >#` ?#d#h0 @= \'H  <""p`<`a@s<b@@s '<X $<^-@@@L<<!`p3<`@4`0=   ? ?   <a@s* `8!<`2bH`<`4#\`6#``D#dT`H#hT`J#l!@`$ @sg#p<@b@@sb&@? $@@2`?$%@&@&H"`  < <  <  㿘1< <K"x @ 㿘  ?< `@㿘ߠ  ?< @p(2?ꀦ D;@ @͔ 2!?Ѐ ?Ԓ?!' D;@ @  ? 㿘<"̀  &?㿘<"̀  i㿘@l͔0" HH/ <bᐅ(" ` ?㿘@..`@6@" 㿘 2 <Ɛ b?ꀢ`< [? 2` HH<b* a   @"-@  <2 ?`  ? `?   `!<!< `x@r+ "@ <"Г*`  ??+@ e @ ?2` <bᐅ( "   @ 2  㿘 T <E!L T& T`€`"B THHo`` </&` ` < !P ? `?   ` !<!<`x@q<"Г*` `?  T T㿘 0  @ @ 4* @    0 6* @  㿘?.@@q@ k@ |㿘 0  T `M `I`€& THHo`` ?</$`  ` < !P ? `?   ` !<!<`x@q3<"Г*` `? w@ 㿘 T3@` *  0 % d"$ D` "  d D<R`R`" d$" L`  R` L <R`# #"   "  0 2  d" D D<  @ 22 d& D"& d 㿘 T3@` *  0 % d$" L` "  d L<R`R`" d"" D`  R` D <R`# #"   "  0 2  d$ L L<  @ 22 d& L$& d 㿘'H'  <<a@pg ( ;<ba- @ 7<!<?bЮ#-<()< "  ? ?    * @p:x@   @p0  $ 2Ԥ(  Ēa$&&H"㿘 '@ x& `@ \" @z @y |& \\&  \`@ 2 <"8AN ` & &  \ \ @  @& \& <Ò 8қ   "@ &   &  &  $ & $ g. g t6 t i. i (   @!& ( @y  @y  \@y"  p @㿘#@  \  @2`  "  B "* 0B82`2`  㿘'D1<!<DbpEF@ohG  J + . *`  (*JЇ8 .*`J   $J    <<b@o4 <X` "` /<f @,@ F<"<)<`@4 : p<"<#0  T ` L#\ #d#` X#h #l $#p (#t t#x < "? #| < "# `?# x#@n"@n@    2`@`$@?&`"@  '㿘<!@ )</<f-<@  * @ @ #0O% $ 440  #0a@"@ L @  l `@ `  4 L@@       2 4 $@`4 @ ѐ @㙐 @2a@<2<#4<#p 1" 㿘<X <`"X" )<f *`!@ @ ``?$`   㕐]2` $``ܑ*`?$㿘<X <X`< `?@ 6<# $!<ᘐ#\  <#X  "<<$ " & 4 < $0X @<c$@"X@#\" ?$㿘<!@<a< 8% 3<<#,c@ ְ <#Pc*`" c?<a  #!!" 6 : !8!@" #!6 : !*!<""!a#8% :#a耦 5<!)<#!)<7<f+<X` %`  ,@@@P## 1  @# ( @"@ L @  l `@ `  4 L@@       2 4 $@` " ✐ ?d ?@2 $&&` ?$%`#`<#,2`c)%#<X` c@`c#,@  <^#8 #<#8c0 %#cc?䀢  %# 㿘<X <X`<@ `?7<f %/ @  ;   d`d@|=  2- $@ $$@1  @,$ `?%` @3` 4 &`  &Ր&J  ͐ d`P `l 6@@[ 1@?%` #<!<cP #8$cP$#8$#8$cP`` @`  ` Ґ0ᛐQ <#P ?@&@"@ ?%&㿘<X` "`` ` @˞<f. !@@@ 2@"@`` ` ᙐ0b ?$ x` '`4 '''''쀦 <  <#`  2<<#`  < 8@@ ?`  $ @cK `   @t @q     -`<<<Øc@ @ *`*2  2 2 <f,@@ "` d2 h@2 t2 p @2 l 2 T2` X2` 4 2` `2`    @~<c |  '܀ y  @~0s @u{ |<@ `L "`"`"`L"``"`"`8"`< "` 8`a@"`@Zj܀  8  `ހ`0 8 a@ ڀ " 䪒   @~܀`` @~` 4$``  `W `͐ܐ3܀ ܀` ` @~` 2Z d``9-`3㿘 .    @~z$  L@2 d   dÐ#<<< p   h* + 2 t@  @ 22  㿘 (  ,<#`#< $a@< ,cD" 8$ 0<#< 0 <a@$ ,#@a@*  ,"@@   ` @_  0a@ $ 0$ ,㿘 (4 * p 3   $  A p  <!@<,0# L "0"0<#H0 "," "0  @^  p @}͐ 㿈<`    ' ''' <<< Æ0 <f(@ .@ 6 6 (q<T<d2fh 2aT2]X 2Xt 2Tl2P2L.`0C/`0 "  /`0 < (D('@/`0< (( ( D. 088@ @7 &   &2d .+`0 .`0 `C<T<!@"   "㿘   @}  㿘  @^  (<!@`"  " "㿘 <`#p ` <#̐  p @|ɐ 㿀`l <c'`Xa\`d 耢  <``  ?͐ 2``   ` '@sW'`` @ce` '@s8 `5@" 8""`" "  2$ ?T" "  C D" " $`T"$ @"@" $"$("!,"( ?T" "  C D" !,"("$ `"P㿈<  8 (' %?  "n? t(2j?ꀢ  2c? @b '#\  @n <P?<cݲ | <G?ɐ x "D""d"T*t"h"X 4<%#|"\"l" "p"` "x"P`"L<Ґ ("@"L8@ <#`" <<< @ <Q!`"@<<< 4`#@@ 2`* *@  3  3  ( ~ `  'Ȁ.?<<< 4`#@ @2`* *@ `  3  3 <  8 `/''''/񀢀  ?   ` @ @  <ca\   <``  ?͢ `"< ؒ ݰ?ꀢ`~`2<<%##\@m̀ &˰?2)'̀ À`2°?0 2 < <A#?#\@m̢ &?2)2 t`02 t<#`@ $  @ؐ`@@_ @ t(2<"?<cܬ | D &X&`&d&T&h&.t 4<&\&l<& &p̔4#p&x&D&@Ȓb (R&L t(2Z??2Ȑ @a '#\  @m[̢ &E?2) /<cj | <6?ɐ x &D&.t&X&d&T&h 4<%#|&\& &l&`&p <Җ`&x&@&Lր  < * # &@&4&L֔ (&PO @ac  '̰?㿘<<< 4`#@ @2`* (@ @ 3`@ 3`@ <fa@* @d2h2l2 p 2 t 6<2d<@8 ; `  ` ``2` `8@  <#`" ?@ ?!@" @z1 @z,& ( Sp<%#| 4/'  ''䀎' //񀦠'!<%8׀?"g?@l: ̀ 2  @2 `4'쀧 2ې "O?` I?8  䀢 ? @` '䀢 <@ `    @`' <c䀢 ' ''#|`4 '/_' a\   <``  ?͐  '䀢   @`M ' =/?ր U  䀢 #|'`4' '*'??# @a쀢 `@   `8  <`` 䀢    2'@o' 0`4'?  `P "?ꀢ< /֔ @ 8   /?@2`P?`P  ր  $'<<`(؀  2  ,Ԁ ('ؒcړ |  c?$ $ d, t$ h$ l$ p$ T䀧 $ X`4$ \$ <$ `cp $ x$ D<Ґ $ @$ x %䀢 $ x`P <ݐ!$ Dր `<#`"@  8@<Q<ݐ!`a$ @$ DА <<<Ò`#@@ * / 2`@ @ 2`@2`@$ L C㿘<<<Ò`#@ @2`* + @ @ <X3`@3`@  `"<f!@*` `,< `d2$@`h2 @`l 2@`p 2@ `t2@@`"` @x]` @xX ?"#@`2`d "&㿘 㿘`?Ȱ <a㿘\ ?D;@  @`?`?    <<a@d<X`  "`@߮ +<󀦠2@ `( 2<bD "8)< ( 2/*<  , `*  0!#\#`#l#d#h a@" #p #tb耢 "#x  &#x#|#p@dj@!@dfp Φ ``a``* `(  < Ԟ `L@  "@ `" *` * " * " a@* @ ?t <x :  " b :bД bЀ  bԀ  "a@#\ `(<!X #`2`P" #d#d#d2 #h2`@" #h#h#la@"#p?#t#t2 #xb耢 "#x  &#x2#|"#|b#|2 #b耢 "#  #p@cϔ<@a@cʔp@@&$& ?%@ & & & 㿘<!L 㿘<"h 㿘<!ؖ 㿘1<!L  <@cb<"h  <b0@cx<!ذ < @cobP&@  &&@ & @<c  #\ #` #d #h $#l (#p ,#t 0#x 4#| 8# <# @# Dc## H< bp  #@c4<bа#\#`#d #h$#l(#p,#t0#x4#|8#<#@#D##<c H#dL#P#T#X#\#`##@b@<ca`4# #\#`#d #h$#l(#p,#t0a`#|<a`@@b#x<eaa< @b0@b@&@  &&@ & 㿀<^    #\#` $< #p bx #d #h #l @b (<@@bc@@&@  &&@ & 㿘"Ѐ "&""&"ȁ㿘<!@&"Ȓ@ի"́㿘 0 "<!@"՟`0U!{   )   `€ t  "€   <6#3< t + ( <曐#`0*@^:0'!,  (* . (8   P@ <ca`` ?"`  t `6 "@  0#q <*  "     2   <"( "" ( "      ` 2   "  <(    ) %? @` 2  "   "   "`" ` "  2??㿘 <ca `% # ` "@ 2@  @@x     "@F@`2` @Fא 㿘<#'D `  `?@ D@M 'D D :`<嬐 XD `p@tʞ DD D D :`* :D(` ` @tD" (D ```   D (@@<c @ `*` " ` , 8'<D`4 ` @E` .D `4 ` ` @E` `  D  @4  :* !@ 2  2   Dq  "@FH D,@ #  ` @2   @D " @S  "   @  `*"@ *`€2`  2 D@F  D  @U D  p@t   㿀'D g  < c` "` \`ג2` *@ π< @ ɒ"```` `B` "* `0B8*   @  < c̐ # # \ ?@ @< 'D   @ D`DDD(        |D  cD  |"    f  @ @ ` ) p @sd['D*i  @D ED 1`1` '<#`"  (   8 /D )<       #\ #` %#dD@*D DD  @T2  D (@@`  "` D  p@s)  㿘 *d  < c܄ @s &@ & & && & & & <cx@r㿘   `" ( ("`( ( "@  '<   x@r p @r¾ @r֞*͐`2  H@rʞ* 0@rÞ*㿘  <0 < "0"<   @S 㿘<b"8  %<#<cԀ@*` `` 2`  ?܀2<b<` 㿘 0)ǒ  < c܄ 0@rc "C @ H `*`)  < c܄ H@rO '&@h 6 & & `<Ԑ!x& ,& $& & & & `<b` 2 ` `   ?"8*  &  "(@ #  & (<c܄ 0@r3**  2    4    2 㿘T? c @ n`  u)<   `$ m$   \  $ \ $ $$ <Ւ>$ T@hq)<T $  5@  \ 2 p @h_T@ 2   (   @q$ (  $    @#  `g, g`  t4 t `v 4 v22 8 # 8 p @q## )<  < ` ` ` s `#`<  "`<㿘<< #Вc`4<ܔ  "`4`<b* 2 ` 2 ` `   ?8*  "``2 ` 2 ` 2  ` 2 i `? @ , `*``,2`@5`@gȔ `  p`?@#@"@%` `  ``@& `"@  `@@<`@% "  @  $$ ($  ` "`%` `"  "` ܢ x@p p @p @pܞ(Ӑ *$$%%``2$`  <0&<<!@ؐ`e   < `!( ` `  ` p @p|`<` "`< 㿘'D `5`,   h D D g D   u (`@" T`@e  < 2 cJ@@# lL " ` D D Z  | "  f   @ @ ` ސ p @p;'D ?? ?  !* . 2 D@6 -``\2`  , @< `: 7D 2L * ? `` 2 LDU D2! :L@D  "DD D :  D :`L@ $ D  ,  <D  # `"  `PD ( \ @<ݐ@ N`l <( 4 t*$ H/   ?@f H*o``Z  \"@  | @ $ \$ <ג ֐ 8  p 0@~  @olw Js @DD ( \ @<ݐ@ `le <( 4 t*$ H/   ?@eǔ H*o``Z  \"@  | @ $ \$ <ג  8  p 0@-  @o& " D `"D @P D  @O D   @O D  p@n?㿈 , 'L @eo`` @ek ``*@ &` L ?@e\  26``@`  ?`@@`  ܐ?`@4T@ba* $, , @b#'`   @e&?0   @f `*@&`.`    @f  * @*@$ , 㿈 @f  `,&  ``2`(.  `  x' `   ` .  `@d `  4   4? -   &  .  ``E@  ` `.  `@dÒ 45 `@   4?   & `-" $ t?  "   *@ & @d @`S "-  & -  .  ` D   `? @dx ?   ?@dn ? `    @i̔  " @dZ?&  -- -    . . `   @ * &    "  -    .  㿘 ,  `$ `  2   `2 @e$@* @*@ *$,,㿈 ` `( 2 `, @e`     `*`*.  & @ `   P @  " `A` @ ,@  & 4 @4` 646 ` " D"`  ` 7`0" `0$` ``(`  `2 @`2`  2 ``@c `@ck @  `?* * @$@& .   쀤$` ``•@$@`܀` @x?@cj  @&  ` ,` @ & $@.  ɀ$ʬ` ``@4 `` `  "`  `0J+`0G$@.  `?@  &  ``I,` @$@` .  `x?@c$  ``@  @ &  ` /,`` @~$@.  `@@c  @^쀢 `"  ` @  &  ``,``\@ !! `"]``"L@ST@_a* $, , @`^#'@bӔ  @2& 2 8$@`+.  `*  `@,`   & $,` ` 2@ ` 2@$@. `2@\@ !! `"@$ ` ````%* @L ?㿘     ???@bV@bt  @      ?@d* `#@     ?@c,   ``2  ?,  @@    ?@c, 㿘 ? "  9?@cӒ D;@  @j  "? @b *2*    $  ,  $ ?& 㿘 ,` (   ` ?` %``@: `  ?    T@g9  2`<`@%`?\  T"`,!`@@  ` ?I` %``@*@%`@ 㿐 ,   (d g 2a? P` `@W   " `P? *  @KF? `@9 `@ao  (& ( 4   (`P?  `` @jӞ& (  @j˞`P   @aI @`$@ͤ@    $ 㿘( 'D  \"@ | @ "\"<ܐ   D\?|` "\"<ܐ L D <* @ *@@ &b. 6 b        6 b<.  T &  X& bc. D^6 6  ""  `2`2  * * @& R    (D?"D 4D  @K& D  p@j)$6 " ```` `B` "* `0B86 D (D@㿘 ((`<` 6 t*& H/   ?@`p H*o``Z  \"@  | @ & \& <ݒ (. `8  p 0@0  @iŞ??㿘< (c`$(   "`$& 6 t L@! ` " ` : 2  `2 L p @i2P rL @" (ې ((`<` 6 t*& H/   ?@_ H*o``Z  \"@  | @ & \& <ݒ  `8  p 0@  @iJ?(?㿘<# $`" $ ((`<` 6 t*& H/   ?@_ H*o``Z  \"@  | @ & \& <ޒ @h `8  p 0@0  @h?ݐ?㿐 'D`<b`'`  `$`<` @h `  2b bb `d*` D$`<   @ ` T@ 2$`<`<`` @hD " (   D\" |@ "\"<ސ  D<` 2 `"`   B@ @ "*`@0B@8 2 l X , H  X t h t 㿈` `(`'\'x'''   4㿐`  ` '  (㿘`     㿘`0`    ` `0     & l   ́㿘` " 4   4   4   4   㿘` 9 7` (8?``$ 81?  2    %??`(  (Y  0? &` &@`  ?`" @ 8  2 㿘"` 2;?  `5?ꀢ  +  <c!`!`2 `?ɐ ?@"``@ `2``"?"`"`"@" 㿘" ^  Y`, "*` *` "**"`"`?"@2"2 `&``\'@ @"&`\&` @`x 4 *?<#&`&`  @@bm H`&``` "`&@&`"`" t  "€`\  `p @bX6㿘" k ˒  f  \`   $ \$ < $ $` , "`*`"`*`*`*`"` "?$@2`"2`   $  \" @ " $ \$  @ x 4 *?<#$ $  @@a H`$ `` "`$$ "`" t  "€ \   p @aƐx ?H` @    ?""`& $$ $  R \@$`` &`` : p@  , 2   ""2ؒ <@X& 7  7  "" 3   "`@&`  @&"P ``<"@&"P p @auS  D;  ?``? `D;  `?`۰? `װ?֐8 @gͰ`K<#*` € ('||q   0 @a"`` , ! (*@!:2  ( 2"  @ "| "4 2<4@9"|@Y'| @`||  ` { "  ?"  ?"  ?"   ?"  ?$"V S? \@ !! `C?"  0  @` <c2 $"J@ <$"\ @ @`  @` V <# ?$""`  ?ր @ ,"?," @ ,"   @`b@ H`@    ?& "`&"""ۂpѰ ƀ" ɰ?q,"  @ k," (D; @^   @XB (D; @^z    ?   $"<$"@R%  2 ?π`" 4 ? $"z$" o  D; @^B   @WD; @@^2    2U?򀦠#@PXN@PƐJ @  C\@ !! `?4? S)  D; @] !?@_ \@ !! `  ???ցH`8?Ӏ @fȖ D;D    ? ۔?ꀢ`!<!$*` € 0 @_'"`.` `@U  @_,2``  D̰?'0`@8D D?' ?򀢠  @]k   "" 2 "2 "2 "2  V'"S'"P'"M'"J' 0'  @^Ǟ <  '  @^Ξ 0?q?"*'"''"$' 8   ?' 2Z?"'"' 'D@] G D F?֐? $ !    /D?'`0?D@\    "  ? 8D?D'`?򀢠  @\ƒ  ? !4!4" "@(" (?8" "@ 㿘 "  D } <" D D " 2 !̀ "/  } <" '   < "\@     2? 2< "  } <"0ؒ㿐 0 @]! @]`` A 㿘``8a`_@`( 2bPԒ>``  `  `(?: 0  ! 2 A 2  A`v 2 A!$  A2!$`l`P , 2`@: *b  "!$!2 㿘 t  8  !   l P@,  P2  :  " 㿘"@ "!@"!A= s@&;= ( $ 0 @]> @]H2 DD!$   !  `? ( 2 ?ꀊ   P l ,  D; ?&㿐 (>:  'x'>"P "P @jn  (?: `@ w  @a? є [?" W?  R>$ 8H`@ "'"@ 0 @\Ҟ (< "P $H` `2"` @\ (< 2"P 㿐"''*@" 8H`@ "'"@ 0 @\yA #"P ` ƴ@R    ! P l@  `2  @\7!H` `2"`㿐'' 0 @\%2 8 8H``"?'" !a!H` `2"` @[מ 㿐 0 @[͞ (>`: !  ' '!'" * "  <` `8` `4@"M`@M`€   `؀ * "@ & ` ` 0 '`@Ǻ` ?"P ŀ  ˀ ` ` 2` X``"@``\&@$``@  a0  $ %a0Ia0%a0` `"44`&`\@ $`\$`< D;  @Y  ?'` @T,`\1$```\@ $`\$`<D;  ``D  ?  ?'@SG@T#@?'$```%``@@$`@2a0 `H ,`Ha0? %a0 8 !``0"`, 2`"   @8 4 2 X@ ` 6 @2 @@  @   h  2" @@ "  ?  \!``X T@ `H  `? !  / 8`\  8`\2 @ T    2  T``"  T X \"  L   ,`@  ? " "`T@   `>  -`>`P@  <`  8`  4@"L @L €    ؀ * "@ & X  ,`H,`I `H4`J ,`H4`J  X`` ``\ ` $`$`\$`<0]D;  D  ?  ?'@R%  @S#@$``?' $`` 0`$`@$`<@64><6`'*&"P2('"P @0  '2'2?  ?> ''`p @Y??'``W!@ T `H  `? !  / 8`\  8`\2 @ T    2  T``"  T X \"  L   ,`@  ? " "`T@0   `>  -`>`P@  @YS2㿘 ( @㿐 v !!$ $2"Pe?ꀢ "P @،\  u V? (    . uK  0 @Y!$!6  !'/ $$!$``  $€`"  ('@ & @X * `& &   ? @X؞2??㿘 D p?$ """"`" @X2 D  D"  ` d `p ߀`!``` , @  , @ `8a H㿈"P!  'H'X''  '"P @l  (  f?HX.] @ . u` @X^?༐ '!̤쀋!2' 8H`@ "'"@ 0 @X%ֲ"H, ! D D    @   < <  "@  \@ B "/ d 耧 耥@ `"P "P   (  u  ? @W2"" 5""*@" @Wq p @W \"$  "@@ `2   v ` $?$ ` 2 * H@@ >@& @W ,$$ \ 0@  @  * p / d`$?%'  '' "`" @WsQ $ / d  6 `" $ " @ ` !`>?`H`  $€X ("H` `2"`!N @W2ߐ㿘 (< X  ( `. (   0 <ca``  !,* 8   P@ `<ca`` ?"` `" ` ( 2 `"Ѐ 2 `< P ې `㿘` (!:  0 @V @ @V㿘!4`"4'< ( @@ "X? 6"Xऄ @V"L?&"L $`€<`` ?`24$8$4㿐 0  <Z"p 0 @Vg ( !,  (* . (8 o  P@ <ca`` ?"` 0 t `6 "@ Dp  @ <"@"@ @ @VF2 D$  D@    ?$ "`& D"""2` !, (* . (8 (  P@ <ca`` ?"` @ `  `@`R 8''H`@ "'"@ @U  $ (,@*   ``$H` `2"` @U (  "Ѐ < P ߲ @U p . t㿐'' !D8H`@ "'"@0  ! @Uv> @UX "!!DH` `2"`㿐! 0 @U/ ( B  2 @7  1" $8" $`€ (<`` ͒"X w?`6"X<  ` @ @T 0 @U2̐&"P 0 @T2  㿘!` ऐ`@ (?D;  :  ? ? " /?" /?֐#@?3l|  @ . / q? . /. / 0 @T਀`X@ T `H  `? !!  / 8`\  8`\2 @ T    2  T``"  T X \"  L `  ,`@  ? " "T@0   >  +>P@  @TE2   㿐!` `` @HD;     ? 28?򀢠8 0?" `l"  /'?" /#?'  `?'D? D#`?򀢠  @RZ ? 㿘 w `<  ` @ @Sž0  w  `<`` @SǞ 8  T Ҩ Ҩ Ѽ     , ,  , H H 4 4 <@ " "@@"@`" P@8" *0 " 㿘 (  `. )`` 6&"P = &"P!,  (* . (8 u  P@  `<ca`` ?"` `  !6 & 6 ` g  t `6 "@㿘C! T T" @``3  /.<@ *< `@@,I  \' \I.I X@8' X  <@ހ2 T㿘`  2 * ?`.À$` ``2 `@|`v<!`*` €`m` @h `"": 86:^ `[` @V 2T< l`"O.  `H. <Í# =.Ā` :< h`5 23 ..&*&̀`'` @" < p`2 .&؀` < p`  ` @2  2(< v$` @ "6:㿘! @2B ` T =< ` <& j j X `, j ] 8`* @G , L 8 : *   X$ L$ `9$ d@= P  `>, j X  L 6$ L@א02 ` /@&@" j j ( ` d$ L `@ , j$ X$ `  X  @` T T@" @ې P@ 0@㿘 <!@` `@@<$ 4T` \ ?$ \  2 $ `   X ?$ X Tp?$ T &$&`?"`"""""@Q2T T"   ,@ 㿘!`",`@@ , D*>" "D  0 D Pb* 8 @  S <@̐" 0" " H0""H* * ""H ?"HTH *?"X"\"D *L0?00D(  *L0?00"PP 8"PP "P㿐!`  )* ''  > "$!<!@  $   ` 2 * " $ X $ 2  ( 2  ,@(   0$ $@$ ($ , $ 0< &"T ,& 8 "@$ ,&"T > :     X   ?   "L  L d@` $ L h  `$ L4 h4 hL À  ,E T ?   T >, ?$ X8$ \625 T$ D  `2`"@ $   H2 "  $ H**$ $ H H @*   L2  2 2 @   $ P$ P P  $ P T   T T@" ? "`D@  P@ P"@ , @   !` " K    T  ` Ɣ , j 2  <2$ ` @@2 $  < " $  8 "$ @& $   "   } <  8ߒ 㿘 ` @ "`   " 2  ` "`  <`  " `" $ $"`$ $<g " " !"㿘   2, `< 0 <'  4}@ < @ѐ€ 9 `0 5<#&`&` `@`x@Oa  %2 @ <c ؀`2 @ @"`@@`@ 0 ,   2`* @@  㿘<ga    $  !$  $  , (4  *4 * 4  ,4 , ., .!$ 0!$ 4 , @ ;@:$$ ő2@4 8! ,  $ < Д @EĐ P ` @E  `" $ $"`$ $<b ! " & $2  *  @""  p$ @ `$   "`  <c$  <`"@ & p$"  $ "@ &?" 2` *   $   "`$# @$ $ ( 2!,<ca`` ?"` !, * . (8  0!,  (* . (8 ߒ  P@ <ca`` ?"`  t `6 "@㿘 @&b,@p`(?` '*`<!| €`( .`(`2 <ca`` ?"`  @ 6``( .`(`<ca`` ? "` 0<`(n P`t b@b  ؀`+ ܚ @' "`@ # : "@` :"``@0@6  ؚ @`""` ؄" ؁㿘!؀N!`<   `@ # `@!쀢  &! 0AH!      @ @ 2&&  #&  # & 0  ؖ? ؀ * ܔ""`<#`@# ؐ  ؁ ؔ  `< ܚ   ,`@< `@ " 6  ؔ# @`""` ؄" ؁ ؆   `@    2 @" 㿘!P D@ ! "   } < x  p` ?"`$  $$ ""@M23w/" L } <f L€  @`?"`$  $$ ""$ `` $`$$ $`"@ @$  "  <@ < @㿘!``< 2[`@``` , "b `k <   D 8<!@" D&``@` "`&@&`"`"`@$```  dL` `k ,`k` @ "L``8`\2 @  ` *@  @ $` L`€ `؀  M` @`,: @ *  $`  " `  } < ǒ `   $` `k`p ,`k @Lߞ0 <` "` } <  }`` ,  `k `  @ ,`k$`  $` } <`<! `@ `` @ `2`L`€  $``<$``@$`&` "`&`&@"`b$`'`<  &@&`" $&` "L``  2 &` "`&`&@"`L`$` >0: <@ـ `\ \@ )`pL`€  p  &@&`" $&` " `?"`$  $$ ""@LA0  @L7㿘   \2 *  a "@  & \&  2 *  \&@( \ & \&  \ 2`@ @@"" `@`4@ @~    @<Ԑ!X $ `t  b€  㿘!  ,`@  T X \"  L : T@&0   >  P@ k 㿘``!<` `"` @@ 1 @ -!$ " ! % " !   !  !  @"!$  " v " @`$ "$!$$! $ 㿘   } <`[!<^ ``" @ `  ?& @ `` @ `"`""+4 p\  $@KY2 7  @" `  ?& @ `` @ `"`"2L`€ 2$`4@* @ ?㿘 < @!,   @@B @  ,  $ $ ̐  "8 L À "4   Ѐ@ <!@ Ԓc"   2 * @  <ca``0 "`0 `< @ `@ ,    Ѐ <!@$ $   * `<@  @2`@0*  8!`L<c`L `p @J2!!`"I ǐE a``0 5"`0 @2o`@ @ 4@4j`@`\!`"@  &`\&`,  $a,a($a("$a,$a( D&``"&@&`"#`@$ "€ Ԑ k , k @ "` 8`\2 @   *@  @ $ ``a," * @` , @=  ,  @  `  !!@" `@ ԰ @ Ғ 2а `@  @@      ,  <  `p     } < !  @ `p!@  <c } <ې!<c`0`o"0 g{`p `LŘ @!a$" a 2`* " 2` `" @: !$a$ t`"€ `\a,@8$a,a(b$a(@"$a,$a( ( 6!`" `k `k ,``a," * @` , @{  ,  @  `  !!@" `@ -@  2  `p @Iq O 㿘``   !`<@B$@ €0;( "`L'" 8 $`<" `@:$`€ 0"` < ` @I,&(& ``<@<#&``x&`  @@I 㿘 (!   "  2  @2g @X `   Q`pY @e  ) 2Q `L @2L  :`<$ $`<`L`< `$ `< $ $ ,`<$ $`L$ (`<$!`<$! (. ( <ca``  "`  L 2 L !?#, ŀ@, Ē$!L   $L À <!@ $ $ @ P6  $  t 26 4"@"ǒ . 4  3< ( . (`<ca`` ?"` x L À "`<<!@ $ $ `<$ `<`$ $ ,`<@ $ $ 4@ 8$!, ( `p  <   ,  @B @  ,  $ $ ̐:  "8`@L À "4`@  Ѐ@ <!@ Ԓc"   2 * @  <ca``0 "`0 3`< @ `@ , `@  Ѐ <!@$ $ `@  @ @ `<    ,  < ` @  ;`p@7`pP/`p!$`L (`"; ` `  Z` "P ~ "  ( . (`<ca``  "` 6  $  t 2`L"@`L$  đ* $ ,`<$ $`L[$ ("  } <j!  @2N    ( 6 . (<ca`` ?"`  t <"@8  P s2  @2. `p  @2% !,  (*  6 . ( 8 V  P@ <ca`` ?"`  t `p"@`p @!la$" a 2`* " 2` `"   !$a$ t`"€  (?` 6<!*` €`<!@<-!  t `@`<"   "@lU `\a,@8$a,a(b$a(@"$a,$a(!`" `k `k ,``a," * @` , @  ,  @  `  !!@" `@b@E 2  `p @F  㿘``, `!   < h`  $ < l`<   p`"`  " `L 2 L€ " `؀  * @``\"`|@ &`\&`<`<"&`&`&`  P`x@FB *, 4@ 2 4`` <`<* * $`@*@$` $` `,` ``24` , @@:$$ ő2@4`4``4` ``*4`:  Ő `D Є `$`@B $``""@A $``!2)<c@#-"L`  `D@B $`$`Ж` $`L ! )<c؀ * @Aa  "ؘ  ""ؖ``\ `,k *@$   "ʐ!`$@(`"(@㿘`@!`< T "@  $ &` "&@&`"Y"@ W`H !   / 8`\  8`\2 @ T   ``"   T X \"  L `   ,`@  ? "  <!@&`D T`@`$ $ T[ h!  P@ 0 "$  T   >  , > P@͒ 㿘   X `\`" Ґ 2 T? X```  $`$``<$`<`@$`@`H  .`H`J@ .`H"@6`J4`J ߀ "4`J`,`H`\` $`\,`I$`<:` @>$```<`\@&`@`&`\&``\ `@=° `D&``$`D@`$@$`" &@$`` "`!:"@쀠 4 !<  $ "428㿘! <` 8` 4@"LL€   ؀ * "@ &  ) z l  T! H `? `!`  /`8 \ `8 \2 @`T    `2 `T  "  `T`X`\" `L  ``, @  `? "  &` \ ``@$`$`<!@ $ DT @ $ :$T 2` ! P@ 㿘4@" !2   8 : @ 4  8<ݐ! 24<" ֠ 4 & : @6  4 @6 &  $@@8@9B㿘`f@  `@ @ p `f  `@ @ `d`H`\ _`\ `I [``" UR``?"``$`@$`$@""`\ `` &`\&`<`@:` @`6 '<6`& @& <& &`K+<c ($&2 2`  `& 8 + 2   @5L@5# &`/?#  2  , ( ?#* 8 $ *  p@&@6& D2  `22  `& @B &#@`#@` @A &@#@#@& ` <- * & a``( "`(㿘 ! X<```  < &`&`h$ , $ $$ $ ($  &"P  &! l 24 :B 8! :?쀢   ?4 : .`H.`I6`J&``!Ȑ&`<`&! &`@$ $-$!<`l" 2 " !Հ  :&" " 8 *2  @ @4@56#@ &!.!դ 0+<c T)<?#@  @2` @ ,@ ( @ @?#* 8 $ @? ( . (`2 a`` ?"`  L@(@!$ P, ?$ X$ \&``&&@&`!@&"&`D T $ Ta``" P@  @?r:㿘 * 2 8<!@  &  0    㿘 ) _! `X ɐ 2  `6  *@$   P$ ̒ 20E `X   @# # + H# `+ I3 J  ,   ,)< T T "   ,<  " @   @      ,@ <@ a@## <# DT 㿘 ) Y (4: S!` "1 ``, <@ <*  @"@ "  =` T@ $`$`<!@$ D`T  @$` $`TȐ`t $`P@O 0 X-   `X<   @, H$ , I$ $ `4 J`!@$ D$ @$ <㿘! D ! P"* ` , >$! $ D  @ < < < bL"!"!"""""!"!"!"!"!"!"" ""㿘` !``<0`<0! "<_" <!@ !<!@!<!@" @0<"0"㿘! t " A! "!;!! 5" 㿘"T " <$"P"@`2 !, ((0: "!,   (* , (8   P@ 2 <ca`` ?"`    4 㿘 ( ! ?``   < ?@ < <` <`H <€ & << ? |@   `<   < @   ` (  !6 & 6 `  㿘 ) !{  (   0 !?0# 㿘 ) 9! 0   00a< )"T " <&"P"@ ((0: "!,0  (* . (8  a P@  <ca`` ?"` 㿘<< ؓ*`   " D? ``@=3Ԑ  $ԁ㿘<`<? +   & D  D"`H" <& L & H ` @ @<D"HH HH<D<"@Ԑ ؄*"H@@"D@D H"@"L"H㿘 D H H H< D` & H`  @<ܞ㿘<c< в2`  d <` , U<c!`  0 K w "H (!": ; <a@!< " 1 < ! (% "T " <$"P (, (`* 8  Ɲ P@` ?% t ` 4 "@ < + >#! < @@ `Р 2 0`Ф 2`  <`` 2 2 @ ? @& 㿘 ) ! 0   0g T  !!  _Z0[` "L S L €  T T" " ? @@" ? `I *`I@`" ? @@ 2 `I ?$ , $ X$ \ 8`* @0 , L 8 : `*  $ d$ L4 h ?, j  , ?$ ` T@"  D  P"`*$ D$ P 㿘<!@ 1<g!@*@Y0 Qa4 "N D-< (  %@ 4; "$a8<$`  & $ $@ @;a<<`$a<aa4  0@€ !,` "* , @ $ $a8"$a8@2  20!@㿘<<!@`?  "  $@"@`4 @ $   8  <@ 㿘<!@< &  `    0" 㿘<``Q  <c ԓ. <b!2` @ *`22"  "" # "  㿘<X `" .`6``2<!<c! <`<b#@ !  ``@ @ .` .`2  * " "2 `4` `s <c`<b?@* @52.*  .`2F6  ` @2 "  . " ( 2`   @232 , f2  + 2  . "2 (  2 " 6  . "2 ( 26 26  &  "` "& p& ` ` ?$`㿘<X` "`  ` p "`   "& p   ` "`  <`  " ?$ 㿘 ( 5<X `"  $`< ("  (  <c <g * a@  <` 2    @  `*  &  &  "`$"& $ ?$ 㿘<X` "`  $`2 2" $ $<b ! " & $2  *  @""  p  ` "`   "& p   ` "`  <`  " ?$ <g `@( $ *`0 2   2   2   $   2㿘<X`   "` <c`ԙ*3 <b? * @`<b!   @2`` "` + 2  *     <c <c <c ZY<c Ђ 2`<` * @#+ 2  <b* a  2 2 2  2 ( "+"@ *2`Б2 * @" 2 2  2      2@1   ( 2 0`2{@`?$`㿐 ( !а?  2̰?ꀦ(ɰ?@  <?b$  "b$<#’`"    2? ""b  d  !   @`T``X` @8$@  L   @8r?͂ <@ @8 X  >` 2`[?6 `T" &   2&  d 2 d X& d d&  2` p @8k2& I& 5? d @ *%`5`<" < 5`<c5`:"   `   "@`T "`l"*"5`:`  㿘`?#@!?@ `    ( ?@ ?@ #!4 !4 0` 2  ,`2   2 "  2 0 㿐@  *   ` @ & @ <b+`2@ @  *   `4`` 2<c 2 <c2 <c [Z<c`Ъ @ 2  ? <``(` (#+`2 @ <b* a 2  2 2  2 ( "+"@ *2`Б2 @ * @22  2  2    "  22 <b ( <ba` "` (    %"@@ n<^`"  8` `0>` = V0`* @+ , L 8 : `*  $ L$ `$ d4 h < 0`| ( x< tҒ n<`4 @h<0b!h,  A( Q < 2N 0 <^``  M"`  @Eۖ > <^`` 5"` ( (!<?$!< $!8"@ $`€<``m0<c @<ca``  "`&P.)@0 ⷀ ""T"P@ 0㿘` 6`2``*`@/.6   d@ƀB* @ 2B8 6`` # H ( P`C @.<7*  7'     ''  2` `@' @.~ ' '`  ` B<a  '''̖ <ca``(`4 "`4"`(` @.U <7*@   '7 ''7@.C ' '`  ` B<a  '''ё <ca``( "`(㿐`4   "`0`0" "b  `, <  <  @`T``@`` @5ў<c`, ."`,` آ ``\@.```^ `,`0@B* @ 2B8 4 `4`,`0`` @5㿘 (   4  0` X`  t` `` `(  L@ <c<!"L@ 4<c <``@@""L<``&"L}  <$ `<$ 7 /|/y/z/xX ?#@2!|"7!|@*74 O{`$ Ox<  *  @$ Oz  * @$ |*@ * $ Oy ߐ * $ @4  $ ,$ 0`,$   "< b  " <ƒ  <!$ $$ 4,  $ (<a@<!,$   @4!$a8 ""a8  <c } <#h<ca`` ?"L?&"L<ca``  "`㿘  1 ̒@+O# . (&& & $`  D6 & 0& @" & D" & P T" & T" & `. u&  " & "  "`& "`"p`  @4`( `@4! `  `!,` `#    `  $`< ( < 0 ,(>(?`  @ L P d D H T X \ `0h(j(k&!&! |&!&! !" &!"  `<   `L` `"D  (`0:&" &"  ` ` 8  $ 4 <\8 (<ѐ  6"Z&"&"P6"X&"\&"&"&"&"&"`2  (`2` ``( ` ` `2    (`2 (`2` ` (?# (ŀ@(Ē H  <` !@  Ԑ  㿐"X"Z@42  "00 , ="    !"L"X $"L4"X& <0& ,& d,& 4&"6`<" " 6`< `:`4&a,* 4 @ <#̐ 8 & 4`4 l* @ <#Ȁ@8& l $ < (}"  (  <c <g * a@  <` 2    @  `*  &  &  "`$"& $ p &  "` " & & p& &"`" ` "` `` &"`"€ 0  @3S 㿐!` `F "' `< @  < (  $a8"@a<$a< $@ <`ג<^``  "` 㿐"p``]`   `\  `&`\ &` W`p<#&`&`  @`x@2 (  ``\ƒ @ 0K ( 5` @@ !` ۖ r #`p 0 "``` @ &`&` &`   `" &@&`" "`\顒€ 4`p @2  㿘 g  p <c   \$@ "  $ \$ `$ "$ ^`(%` i   . !` @+m $ `.  2`@  `@B* @ 2B8 *``"` ``0 "`02 * `(`. 2  `@<b(3   *   ` `4  2<c  2 <c 2 <c  [Z <c`Ф  2  ? <``)  * #(2  <b* a  2   2  2   2  ( "+"@ * 2 Б2 * @ 2 2   2   2       2 2   +4`$ <` 2 2 ` 2 *" $ @`, d$ L ( "$ \ 0  +$    `" $$ "  "3 p @1  Ԓ 퀢  p 8 4h 0 p<cК`<X`2`<``   ( #`@"`$"@` 2 $`$<b`  "`#`$0( " @#` @` $"@#`$"x< < c ' ( `?=""b T  X  . @`X``T` @1.~$@ `X` <`` @1')& <` @1 EpTXZ t  &"T"@8? <@T/ @0*  d X`'    <# c쀢 < d e# f g#d#\3#`& 3& d 㿘`<b@ .`2 @  * 4 ``   2<c  2 <c 2 <c  ZX<c`Ј @  2  ? <``* ( ".`2 @ <b* a   2   2  2    2  ( "*"@0( 2  Б2 `* @ 2  2   2   2       2 2 s 2@ "` 2`㿘!" &!" !<#$ d!, 4 :$ L$ H$ P4 h . ( 6"Z"<$!,"H&""D<$!8! $!4&! 㿘ߤ! w <`` @0  T ! @02 T T@    @?$ "`& T @ ` `` p  @/2@  ` @?$`"`$ @ ` `` p p Y 㿘 ` p "`   "& p   ` "`  <`  "a<X" p "` ` "  "`p"` "㿘.`2`@`<b! .`.6@2<c2 <c 2 <c ][<c*`О +`2 2 2  <``." 2@ <b* a 2 2  2   2 ( "*"@0(2Б2 * @"2 2   2      2J0 <X <c(ܐ @ # @ " @  $"@ "$ # <X  $  2 $ $ " $`"`<X %*`0  2 t"  ("   2   2     2  㿘` "   ( ;`8` `  A"` " A V `4"<ah+`  `@ 2" (@ "  ``Ֆ " 2"`"&"P@㿘 @`x 4 A?"p```   `\ ( `&`\ &` +?<#&`&`  @`x@.A DH`&``` "`&@&`"`" t  "€`\ <c``p "` @.' ?~?c`   "` 㿘` `\` (` `&`\ &`` &` 㿘㿘 /?2- ` 2` &` `6` 6` <c6` "c@ " ```` `B` "* `0B86`  p?#' ?` ?Ӏ??`  @ <b,  "b,< h} ?  `( "`?`d'`'`` 'U耢 v 2 '䀢`'b'`" b b Q? `  L@ b bb `@ `< 8 쀢 b'䀢 b'ܰ (L ? `{ `'X耢 'T' b < x< X`#\ ܔʘ܀`` @- 6㿘 . (    . t@㿘 ( 2+?ꀦ&?@8``  ````?π`& & d` <& d < @: @,՞ 㿐@`=?Ӏ` '@@04 2\)􀦀6`` &``  ' &"&" 4 ` $ " 7 "㿘  ! @$  㿘8  !D;@ @*ޒ ? 㿘D;D    ? 2!?򀢠?8  ?& ? @ @*! ? 㿘`Đ2 ?  ?Ӓ  㿘`̬2 ?  ?Ӓ  㿘<X .`0 c<1<"`!b`!"b`b`<e1<!ᬰ! `(2   @;&@8@ `  2 <<e! @&@`(  .`0 2   2  ! !`!5.`0"b`,`<e(`"%3`2` @"` `2` `" `.2 ` `. . ` `2`3  "<X <e(ᬐ @ # @ " @  $"@ "$ # <X `$` 2 $`$<` d "`$"d"㿘<eᬅ( `<?..`00`21` `t"``(")` ` 2"`  `2` ``2` ``2 ` ``@ $` ` `2`㿘@  *  `@  ; @ @ ` 4`` <"d<"4@<">@<"<@ <"8@  <<<<<""4"b82>2<#"d ` <ba` F"`C   A! "  A V    b + (      A<!h- ` 2b `| "b`( b ``Ǯb&bP@*`2`@@ @ C+  0@8* 2 㿘. ` |  " ,? @#! @ &   @B* @ 2B8 *`2``6 <c6 @      { ? 㿘  @   ` {`?#'̨  ?``??#@?@  `  <b0  "b0<  2հ? ' *`  7̰? `( Ȱ?` `'7`d'`*'`7`  'y谒  2   b''` ' `  Ф @ b bb` ` 2  " < @< < 8 쀢 b'؀  b'؀`<``  '̂`$`< @)\'̂` @)C̀ %̒ ؖ ̰ <L ? `{ 3`"`< 2 ̀ @)$`<X 'T''`7 `z' 7'< <<#P`#\ ̖µ̀`` @)   <ea`  "` @s@2'=   P l, D; ?"0 D D  "D\D; ?"㿐@@ޔ9{1 "3\?$`` &`` { ' &"&"䀧` '@ 4 @4    @ $ " *'{㿐8@w?ꀢ   . (<bd& d& j& h"bd <e?ф @ @(_"b"`@  d    @`T``X` @(@$@ /`L " d { 2  d`` @($? 2  X& d   X&  T<& `. ("d6 #"d& < 㿘 . ( . t@z㿘 @`x 4 A?"p``~1`   `\ ( `&`\ &` +?<#&`&`  @`x@' DH`&``` "`&@&`"`" t  "€`\ <e<e!<c `p`` # ?"` "` @' ?w|?a  "a㿘`<e !*`  @, 4   2# t " ( "  2   2  2     2 `B p` ` -@   2# t "  ( "   2    2   2      2  ` w- "#`2` 0  @'v 㿘 <`` .` 6`  \$@ "@ & & \  ( " ` (<e \(` & \& ` "# L i   `*  f<e i 2 L @q*  T<e L @-X ` 4 @<"d<"4@<">@<"<@ <"8@ e  <<<<<""4"b82>2<#"d  <e`"  @q   p~ <ea` p "` @&j2 vH 㿘 <"d <"4@,`<">.`2` ,`<"<.2` ,`<"8@,`,2`2   <<<<<""4"b82>2<#"d㿘X "# 0,+6 .`6    ^.`.`.@.`.`& J@ t6 J` r 6   .@.`.`.`.`.`.`6    ^.`.@.`.`.`o@s` ?㿘  ` X\?@ , ` 2$  2  X<#0 @, $ TH  " <! < 2 <#P$ T  7$ 02  P @,    ̐ `   @,  o @+ h ̀`"  ̐ @,  o @ ` ̀ <#<"$ T  ހ  T  $ 0 㿘`(  `p H    `@`p @%puN㿐   X` ` @` " " D <#``  @   `0< `4  ހ   <   `h#\#` @֒(㿐 y    @<^``(  "`(`` @% 㿘    0  0<֐!o h˖  o`@p 㿐`( `<!0`p @$ܞe ta  `'@ Ŗ <XT  `" <#p  9< @ ހ`$ @ ڀ`$    , `o@(  , @$    @$  Ԑ0 `p @$t] ?$㿐 2 8 2 8P `  ''<#p & 8 8@ 㿘P\'L` m'To Z* sɐ  bZ  ?@& &&o*  \ @ &\&<" sw(6t &h`"`.`ക2\X `" ̐(77 77  7 7o 7 / / o @oT @~ ` o@woo@oL@m &~Y㿘 @ 㿈 `` R`X`o ` M `P J p g F E  ` A*2 ```(6@@ / p@ ` ( p@ $ p`?* 2   @`o  @ ?  8<   p5 "``􀢠$`  p@ "`h  p D <#` `h#`#\ ( ڂ p -<   p (P2Q <p ‚ p<#,`  g c@` "c " c D c,@ c 0` H @`  ,`h#\#` ( , @# p   N{ p KL@2Ep @<#`  0  p 1p+ , @"֞2    2    `h g `h `@ `h#\#` `(2 pfp07p &<  @ H" ``? 2  g      , @"  p   Ԑ p @"r^ 㿐  `2' (`y?ꀢ`  ` {O  `j? <#p  a?_ 2< "cW  "0Q O?``$ 2    ?`` ` @")4? X@/?<X ?ɒ`" <#pm        t `, @"` F`?$`   ހ2 㿐<X?  '" <#p.  `o@V `X 46 @@ ܔ ِ&  , @!Þ      ?$㿐   ' (? <#pR2P?ꀢ2<"#I  D"0B?<X   7`` ` @!<X*? ?`" <#pȖ `    Ә `, @!_`  ?$ P"!T  8!U!S?0?\@ !! `2Dv?D;@ @ D D b? ]?Ҁ ``` U?ꀊ` ?'O䀢 "y͐䤒 D? X7Ѐ ?X@5" !T!T"-?"!T "8!U!S0 0&] D@@0 D  D 2?`<aX'H'P @5<ap@ 8<cp  @  <`D.@Z@  P X2 o@ @ P7<#  P 7<  : @ 2  ( @   ( (   o& @ - X|@o@ <<@@ ܔ!@@ @D@2 $<< Ĵ . "1/<-<  X G@ @ <<!؀a @  @@ P @ @ 2 ̑.<p` @%@H"@#P4 & 㿘<#pV< @ 0  *@` $  -*@ 0 ` 1*@`? 0*@*`J@@-<!<@,*`0" (","0"00  "0  * <(<b@!І"@ 4" 4㿘2   @1`@+, @2 B8 6`? @&  x<! ``(' [ 6 & `  $b  X  '' `   x  @  <* "@ *`     ` "  P    * `@d   @ <'#\b䀠`` @ 0 g (  '`2`L<#̀`b <ѐ"0 @? @.`<b*   R `` ` *  `*` *  R ``  : u L`  *  R "     `  zĐ% m'`//7''<  "b '`'`` @Đژ P`*`  `` `  " P   * `@ " @4"@Ȑ"    " \ '' @<'#\b`` @3㿘<ba` "` ?    "<`4 #<1 !`<#̀`2) w #< "     *` Z6 #̀`2 \ < "     E<!`2 @"  2 C 6<` `# ` `  `0-<c `ܑ,@ #<` ``4   b,@ @  2 㿘<ba` "`       `  `  P<!耢`   ?''/8 <ba` %"`8]T@a* $, , @h#  ''@ܐ  ' ''/'/ؐ㿘` 6`(2<#`2<8 *< &$`L@   2 `X  2<#̀` { <`X#`㿘<b!Ф .` (6```K"!В @* @ 2B8 *``> 9`L @<!쀢`.Ѐ 2%Б+ < * @ # **` * 2 p @2  l ` "` P h \ t \  @ @ @ @ \ 0 0 @ 0 0 㿘 0Ғ  @ 0<bc8 "c8㿘 T C Pӿ  <` P "@ <c 8@<cp& L&T & V <#  @$  P @ 㿘@   #<b @/ ؒ 0c8 ? $c8@" "  <?#p"  @ 2    " "  㿘@  4-<`0+<b ` "'`2" `  "@%h '    2} 0c8?%c8`2 `&@h #    2 ^ 0<b#8 "#8p㿘` 2`K 0<bc8 E 0<bc8?> 0<bc8??K"c8  .`  '   2 ` @( ` `   `@Ӑ `@Ԓ` .`@ 2 ` 2@`@&@"@<"h " !  2   2 㿘 2` 2 `ߒ 0<bc8?ɐ?"c8?  &` .` }㿘t      2 @  " "  xD;@     ؐ@g   "/f?@J : 2-@t5?ݐ"`-<*!*` € @ &4@\@ !! `"@?0\@ !! `2@0? +?Ŷ s~ `? :-@   @  2  ?"aa2??ݐ"`<*!̓*` € $` $` $` $`` ԰?π Ҁb ̀WwȐư`?   0    8  ?   2  `? @Ô  `  ( $ $ `$ $  P . ?@  @ 0   @  8 @ ?  `,  " ?*@ $  P     2 $ ?, $ V `@Q `$$  ` E?@  @ 0   @  8 @ ?   `$ %`8 `@" ?ꀢ  ` $   8  2  ` " , X<D@@   ? x`    - +?%;`#% @ؒ "@@z@vؔؐ 7 'D@ @͔   ܲ`  ڰ  M  4`"E @ =" "  0<&` ", < "# (" (2 (D#`",2  42" (퀢` ( 2  <hh @$@@ ""@<h h@`  `?㿘 F` C<*"*` € <#7&3<%c|3   ? & & & . . & c| @3 @ 0@0T CY0    @  2 㿘< $<&```?<""c #< 2" <(2ܐ   $c㿘 `<#<͞# 㿘  #ϒ  6<`@ɔ#< "l"Ą##t  $#  @ " "@ "@ `, <&"p 4 ؒ?&"p&"l&"&"�&#&"&"&#<&# &0&`4㿘 4 & 4  @ @  \ \ \ p p p ӄ ӄ ӄ ؝㿘 0 @lw  ,`   y  @ . y D    @ggEH` D@    @?$ "`& D @ ` ``ۂ p0  @?gH` @  ` @?$`"`& @ ` ``ۂ p0  @fH` @   @?$"`& @ ` ``2ۂ p @ 206"X P 2,6"X<X  # `  "` " &?"  P# " " < <`` @Şc50 0 @d #㿘 ` 4 ?Ӂ㿘 ` 8 ?Ӂ㿘  2.  `T€ " $? 6 *L@<X "   & &"`" ` "`   && ?" 㿘   V ]? ($: `U?" `8 ( K4"Z  , (`+4"X `T€ <X, (;?`  4 *"`   $ $"`" ` "` `` &"`?" p 22 , ) < @h @ L@"@ " 㿘V  <]# D`<?b  "b<!X D`€&  b7  "?V "``0""\0`<`!` ,","<#<aL(& `s<` , z,"<"h&  @ !! `Z`\ < <, .,"4 a؀`& ,"d 4 ,,"c$#, )$ `H<ѐ $"$#$"<#  $",","$""$"4 *`L€<X` "`   $ $"`" ` "` `` &"`?"  (` @ " Ő0 a ?a?a?Ձ㿘  %  &"@@l x   2&  *` *  * `2& #&  $" € 㿘   D} ( 2y?ꀢ(v?  p?@6``  a?π& & d& d`a@* 2  2N?А* 2 #8 \$ !! `2 :?.` T2`€ " 0?. ) 6 *& 6 `L€<X` "`   & &"`" ` "` `` &"` <?`"` @& < 㿘  " ?    ?Ӂ㿐 8''H`@ "'"@  !0t! ( " (   "P !H` `2"`㿘  `??ꀢ`2 ( * !: & ) N"P J{? `u?i " n?, )  6 c& (  $ ( Q? (  (   _  A>& (`"< "P "8 ) -  ( ( 0 @!,  (*`, (8   P@`<ca`` ?"`  @a\, ) &"P @ 㿘?  :` @@"6  0?Ӓ€ %"P8"`8&`"b$ `(  bP  bP `(  ?ؐ &@  @  "`8"b&`$ @   2@ ( (:2 ?2`  "` " d *"`2` " 㿐 @  '?  @`? ? `@@ &`㿘   `@$? m͔ ?  <`2"P?Ӏ "P @C S 2 ? `<㿘` ` "?" ?  (  & ( * !:2 ? 4 `0€"@ 㿘` `  㿘?ݐ"@`p </ `*` €D;   ? q`  d@\@ !! `2# [?# X D; R? &0M" 2DH?; "@    29?8@!3.1<#؀ #<!#؀€??ݐ"@   $ =pĒ ٨ 㿐8  4 I {?`X 2  Z`` @n? a_ / 2 `` @Ӟ^?$`( Z``  ` `\ `  $`$`\$`<5a $` <* @ *@ $ , , $ 4   X<,  4 4 $  "  , , , ], ``\ `  $`\$`<5P`Ւ   ,$ , 4 @ k*  2`B@8 4 `(D@㿘. $  <!@@  h   b  "N &N $ '{@#<a@ & . $p 0  &N $`. &{@#<a@ & . $p  . %㿘8 @ 2  N $ ". &q0 . $. &. % 2 㿘`.`` * <!@'`@ & #   .8 3<󀦠 2# "  N $  . & a@" $N $p . $N $ 2 {4@a@ @`& . $p7   ـ㿘 .`6` `2  @ * @ 2B8 *``& p`$  ?`<5 <*` €   p ( l` p v  p,@?2`  p @2 `v 㿐a  op 㿐P  op 㿘N ' " . '  8 @ !<X  $ N $ pf . $ ?$ N %` <!@@  D 㿘N ' 2  . '  8 @!<X  $ N $ zt@Ȓ d<a@ & . $ov  ?$ 㿘 Z ( ``2 ``  %"`  0!`2`<5"  "" "*&"*$" ""*%*'  "&  P`㿘    2  ? $  "@b P`sc (   2 ?㿘  8H  8ϒ`㿘8` e  㿘  *& 2 (  2 㿐   @ "   ј  `` ` @o 2 4 &  㿘@< 8  g?<^`   !<^r8    @8`  3? \J bĢ ?А @  2 ` !    $  `?<"  `@ bĐ $@$`%bĐ    @`<^ p #`\+ 㿘"Ā ." @@2% `@2 ``"   2 ? $  "  "@[   2 ?ρ㿘"&"   [ "Ā 2㿐<b@@0<&```= -<` "5`(  <!@@ <<"<"`4@@@`t  '<%< @  L $@L % @#\@  @4 %  2 `(`2`%@&&@ & 㿘<#`$В``$㿘\ ?D;@  @ ?  ?<#   < p 㿘<`` €<ca\@  r?㿘:  *&: &@<<@a  <`   * @&  p @<ca\  ' Ѐ   ր   0p?<@8@  @א<ca\  ' Ѐ  ְ p ?/''쀤 i/<ca\  Ѐ  <``  ?͐ K<ր 2X?  @'@`02  `8  (F 0D 1<#`" 4 , 2:? 4!\' Ѐ  <``  ?͐ $ ր   `2'@@אВ'@ 8 ̀`#` ,  ? ה '@\ ""a Za  W\@ !! `2DJ?;@ p@ n T  T ;?w P`Ȓ@ '"! d <` <c!\ ?   <` <c!\ ? @ 䀢 v?H'L@ @ 0`<c<` !\, ,7'/7''  //퀦`  / L /''  4 '  ؟@ 0 ؟@ 㿘    `   T  <}K"0:    P 1    ?@#  @  P          {4@  u 㿘      @`2 P     ] ` 2`<|"(0H  "   "  "  " 2      1     (               @k 㿘 @_ ! ̐㿘``"0-?0` ` @ܒ 0n? 㿘!`<8#ܓ*` €  ?0  0 0ܐ  㿘  ? & `"  "` `"<"@<b"bP<"? 20 0     2 ?㿘`"  @@"  ` `"@<@   @@    p`B "   8N?@ 2I?c D?`P ; <.@ ` `''쀢/ /<ca\   <``  ?Ͱ .<& 0 ? 2 ?`P  ?.& 㿘<  l*`@ `   D  ?ɒ D@Đ  $`$`, $` ` "`$```"%`@?``  4``  ې?* #  ?"  $```@ ` ?` `0 $ ```@@ٔ   l$ * `"  ` ?` ?` 3 ?  2? ,c`< $`0? `   ` <   @``@  <R` n?<" R ,`,2J` @2E` @2@` @2;`  @26`( (@21`$ $@2,`   ?2&! 0   @?@?  @ ? ??   2 2 , `" `` &` $`$@`$`"`  ?ꀤ`& 㿘< l* '` 2# &`0` ` 2 `` @2  <zH"?㿘  @0㿈@  0@ `2? 4 )  $   (2?р "߰?8 @  @ 2Ұ?ꀢ    2  ` " "!   6`&@&` &` 6`6`$6` 6` ..&W @ ?' 8 8& 4"  ..  .. D"7 D;   @^    "/?@A : 2.@a `4`& `` :.@```@ 2@``d?&      "& 4 "  "."! "L  4 " 2B?ꀢ 2 4 . 4 ! 7   2&1?  22 4 @  22`2 H" 4   `  22  2 L" 4!   ?22`2 P"   ?<- ``"", 0 2   2  " <,2  " ׀ <ԑ* @2 " `" x0<"<"(#h@#t #d$#l#p#\#`@ < #db#\#`#h#l#p @v  " @@ /`㿘k z 㿘   < @ `  & &  & &   *  & %  @ܓ*``&  "?*@ `& .` *`" * &$  & "$㿘 B    @" 4@2  2  2    *  @  .  `@   ז    . .  &.6 "  @" * 2  㿘!<X < 0`$ #p @ j  `?$ ``, @4 `` `kz ` ` <!@  2 & 6  <!@ $ && 㿐 $ S  ??''@'< " 8 2 .  2 .&`` `   @2 2  @ ( @`?z &$ &$㿐` $` `*``2 Ґ 2Ұ?ɀ`  @# `  Ű? ` " 42  2  2 ` ` * @@   * "  "  2d "a    @   "Q     8 "E 2A  @ 2;?"c'!"3 % 2"      `@C "  2   (2 ?d+'?' C  #@ &. ` .&&$` $`%  F?`?$`>? b㿐`  $*  "?`  @F    w?  " 42  2  2     * @@@b "@ @ ) S ! ``"` 2``"`  2`` 2 H "  " % $  Đ?~ ?&    ,  , ?<b  "b+ ?㿘 <""`- ` ? " `*   `"  2` " $A 2 `"$`@`װ㿘  `/ `` &`  6@ "    `   `` 2 @`2` l x         P    L    ! 㿘`     @ _`"  `2  `    @ `"  2    &@$@ @  `"y    &@̐2p   .`?  `` `2\   @.`? @ O. 2L . 2E  "A  ` @  73  24 3   `  ` ?:  `?/ 2   `?@ 3  `  ` ?:  `?/`2   `?@    !`<B (<#<#<#< #< #<#<#<#Ёh'H <t#@!<<Р#t@`2 <"t# /    0 0  /` 4  2#\2 4`0H<#`#d#h#l#p#t#x#|### 2 t ` ``  #<@t{`X  ` ``<` h< x<  tg\ J (J 㿘<" @쾒 2 㿘N <) c@쯐 <! c@짐 < c@쟐 <?c@에 <  @쏒cȀ   &@ 㿘.` <t `#<`t"`  `< sp? *  <*@ #'H77/   `\`2! mg 8<+ `5         *   @ `  @\2 m= < sH#\#`   ߚ       `#``2  7 7 /2 72 7 7 'ܮ J+`2 @ * 2`/` H#\Ě 1\1 P@  @ B  H:@ `B :  H#`#\x  6 7 @  .  `"   '   '  8 H 6/` <`$/`@  \` <s  ?  : "  < " ( <  8@ "`$ <. @  ( 8 ܔ! @/`` `(`$ " \ 0 `B ;@8@  @ B :`  ܀   " \ 2㿘   H@  8  H 㿘 & <`8`?"` 2< 㿘 282< `"`<`?"``<`"8` "`8 &`8@& H  " 828 8`<``"`   `<"`8 "  282`<  "8 8 "`8"8㿘 `2<`" `?"`  8I&  "88 288 2 < `"8`?"`8 8/"8 㿘   @@2w `@2r `@2m ` @2h `  ?@2a `@2\ `@2W "`"@2R `@2M `@2H ` @2C $`$@2>L & &N`&@`&` JJ@ ` JJ@ ``) )@Ӕ 2 <`<2 @`@@2 ?"` 8$`8&   8 2  㿘!<"@ " " @ 2  2  "    B  }$  㿘 `Ē  2<oP!@{ 0 8   & & & &  @ 8@8" " $ ` 㿘Ӑ < " ` @陒 "   @鏒   $   "  㿘  ? D   2  ?@2   ?#@ h  1     )  hY  !  8@ 8 @ 2$ < $ <<"@  @ @   &@   @ HL &`  4 $ 8㿈H/`?` 0<B!L*` € ) > "$ F  '􀦠  - " 5  ̐ ' H     `< / @ @ ( <X<X  #\@ `? , g  `'<B!,*` €'  5  6 = >  <'x'􀦠T `H֐  ސ  ` @'􀦠P `D  Đ   '􀦠T `H    ` ~@y'􀦠Pu `D "o  j Ғ eϒ'0^[ `o U w 2@N K'􀦠 G D'􀦠 @ 7='􀦠9 ` M "3 U . <""   "     'M   6?  '    m' ' H     P?`@ E E ` @x<<!8N&` #\&<##`$#d#h#l #p6#t7#x"#|##########@ٚ㿘<b    H/`b`*` 2 8`` `2`0  H@@  8 @` `2`` -@$&@㿈'D'P'H   H`<" ?D       0 8 < 4  @ @    `    <#\;`@M@P @$    ź'D&H"P 4 㿐<X<X <" @`?v#\㿐 *   @`\ <"<X` <X @ ` `?X#\㿐<X`<X<" ` @`?D#\ 5 6 6 6 8 8 : 9X 9@g^<V" <@o 4<* * @   /<'''̒b @龐'D"!D Ĕ؀ !DU  P  6 P  ",V g0\ݐg, 㿘`\<  \@ " `\  aƖ@#  p @LҐ  \㿘!P/  A!P@  & \!@&< "(<J.!@"( <J* `T*  * # * * %* 6 X& T6 P& f& @\1 & 8<  " ,V* f< " \zf 㿘  <c  <c *  @?ϑ. <* b  " `* $$ @Yǒ?*  <Ā?<""`\A`#c#  2 ?  㨑* @   * @"%# 㿘!<X  $   P& <? & @@Y<c   < +@ @@ `   +  < 4& < @ $& @㬔  ?$ 㿘 < 2` ?*  $ @\ @ 2 $@ 2$ $ .<a?"a  ( @K̐ H` (@    ?$ "`& ("""ۂpg 㿘 < 0?c(@""@22`?<㰅( "   2   2  㿘ސ p  p @ ("`$ ("`<K!\ $ $ <$ $ $ 㿘!<X  $ [  $<! & $"! ?$  (@/H` (@    ?$ "`& ("""  㿘 < @ Ԑ `* Ͱ?ꀦ KҒ J  ?2*   \? |` $ \$ <LJv   $ $  @ ,`,` < !,`  @*  " `  72 \  $ \$ <LJ@$  @t  *`  ,`  (   @ў$ (  \    $ \$ <L$J  ,`..   ^2  $  x`@`4@@ A?bp``Q`    \   $ \ $  +?<#$ $ `@ x@`DH`$ `` "`$$ "`" `t  b€ \ d  p<kV"0 p @uJS㿘 22 4!<! 1pː  +<c6   ` &  `& $& !<a@ $! Y& <!Ԁ` .`2`  6 4$p 4 $ p @2?J?ɒ (& 4H`&`` "`&&"`" 㿘`< 8 #<XA?` $`@M`   `. `+? `  $ $ $`4  $ d` E   $ $@` $ `$ `4 ` `??$`㿘<aԀ<"#"a@H`<!Ԁ 8?8`<I#*` €"` 2 ?  ?2?D;   ? 2?`2?<Ԁ 2?<"#<M"Ԕ`  ް ڰ?А } ԰Ѱ?D; @˔    ?耣`?逦`o<+` < 㨑* b*  Դ ꀢ   ?0?1<!Ā 6?&!J 2`?&!?ِ 2 `?L 2`?π "? @ 2~?ж  VY& @<X` #`&6 &&& .&&& &`4&$`8&$< #.#@ $###` ?M#`bBc0E<C?D; @= <  < 23?.D;   ?  ? @ <="!D;   ?  ?< @ @(<"!%"?ց㿐<!Ԁ H?```A?D;D    ? 0?򀢠8  (?ꀢ ?&  ?``А# '<<!!'􀢠  D @  ? h"a@aဦ@6=0wD;  Ȑ@    2g?<#Ȁ <_?c+  < *@ *" S  ' ' ''D 8 = D;  @n    2?< 2 2` ?* "$?22H'D'L'D @A  ? 2?ρ㿘aԠ <#  c  aڠ <#'<X $, @    2? ?$㿘`<#<  b#< c,@ @ `( 㿘  \? |` & \& <OFɒ  <*@ $  `@,   < *  , , $$ $ 4  ^4 4 `  & & 㿐.<* b`  `. $` \`2` $` \ \`  #`  \`#`0ˀ   ` `~q`$      `$~f  \`   `  @<c`D` 2"`DZ  |"@ @ f   @ @ `2 p G~' F ' p @'`2 ``r` @ƞ0l $` \` $``(`` @? "(  !* , 2 @4 `  @ @O  `  @@ ` %``   @q 4 @  p@|!FZt`\  " @`\\ " `: *`:\ @ (D@ 0 D< @ 6?<<⨘ + "`2` @ (?#㿘`H< &`H`  \*`D @ * &`D"  .? ( l`T`L &`L K<!`F<!`<`P `<@`8" !,6@*&`82` -   "  \ @" `@`<? `P @    `<?6 `?  p @̞E 㿘 ( `L :`I 2  5 "   " M `2  <!Ԁ " Ǎ@   `$   E  ,?ɰ5 ?#@*`2`?A   p  p @j2 EH 㿘<!`# .`2 `@ p   1< < 8    (  p @51?E-?"   \ $ $@ " $ \$   , $ $ @D  ((4 t, i`, g` @ $ ( \  \@ " \`P"㿀<bh@ᇐ<c  0 <"-<+< *< b 2 #\  #` #d #l  #hb@_@@ @&㬤ؠ (&&&@㿈'D<'P'H'L@>b' 7<X &</`@PD?@ ?c $ "H0D #\L9<#`< @LP<@@ 3< P-<c-@" @ @@@@@ c@@#P@L '$? &D`?`?&LD"@ &H"P 4 & 㿘<"`< !Ѐ<!<!<!@൐0< !!. .  .  .  .  .  .  .  . @줐< bhbh<b@ <"d? !<q"@4@&@$㿘"`  @ڐ㿘 k "? "N ?ꀢ  `n8 n.@\   @쮔 2 @2`@& " p p p"@ @2"  "@" """ p"" p" 2 p 㿘<g!ȷ." `2 ` @v 2  `2  0 @k2‰ 㿘 <gȇ( " ""  2  0 @L0 2" 㿘 0 < P  <<b @H?0<!@⬐"̒@ R&"ԁ㿘<@<<S c&"&"ܐ"R&"؁㿘"@ . t (` &"<"T !"` 2 <"T ! "`   0   "€  4  0 @@ <g!Ā`@{ 㿘8 D (  p  p @BÐH` D@  ` ?$`"`& D$$ $  " " 0&" 0   P   <b @?0. ( . tk  R "?Ӏ`?8  *(2Z @" ` "d"h"l㿘<"!<"*`    >ה  "  @ZAz`"<S<["&"<S &#<h!Ȓ &"&"t&"&"&"&"㿘`  ?V  &<? ?Ԑ"&  6 <#&   ?㿘 `2  &  & 㿘  _  2bE? b  :?@,  4 $ +<%< cx@ޅ $  @ݐ2 2 $ $V M  0 @!$b <gb`Ȓ@ `*`@ ,$b 㿘N     d0|'H`ݐ "`?' 0 @    ?' 㿐b 'b 2v?@2r?ꀦ pk e Ȓ  2b^? b kS? @$ $$ N` !b`ƒ   0 @YP8?$b<gb`aȐ *  ($b$ $b 0 "@ `̔ | @72$b+$b?p`<g aȑ*  $b$b| 㿐@  `?`0 @& 7&+ 6V 0 4 2 '` @ 2  0 @?ꀠ``0 @&& " "   2  㿐 "` "°?XZ@ 0 @t 2?( ?À<S-" ""`>      =H  ??w'u'?' (`p`?'t`j`( f`?`a'`_$$`< $" 2$ R$  0 @T, (d`0$"dh $"hl$"l&`@G6b`.`(`&bd&bh&bl` @8&b`"X@ "@&bXD 6XH`$``` "`$@$`"`"€ 0 @ ?` `p @`?`0 @㿘  `0@ 0 @ߞ#" `""d#d""h#h""l`#l +(* ( &&@ 㿘  ` @@"i?V e? `( ?_?#`DH``D@   ?$"`$`D&& &  2  <2;?R%`8 ڰ>03$2bX "@ p @?m0bZ*  2` 4bX<"Q ! p @x ?V &@&`8$"$ 8w$ 㿘 ` ?b 2   6@.` &  &b@ђ` 㿘`8<& "&`&`8 @? .``@@ < 㿀@X 쀢 C ;㿘 @? <W , `@\@ ? <W#&`&`8& 㿐`  `@հ??#@"`ΰ?ꀢ`  6 lİ  ?l?؀ ' " " ` 2`Ő` @`@: w't 0 @$?' d D`˘ X?'  ` `GD< b  '<` @:?Pt ΂0 0? +b @:`H`$`   $ $`$@$ "@€ 0 @F>'0 @=`p @8>㿐 @    ``2??#@"`?ꀢ " ( ??Ӏ 2?ǀ il&2  : ?@4o /` @; 2 "t0r "@@   ,@k `$ <   \@  $ \$ <Y4=`?Q  p @Ş = "@?0> t  p଀  D @ = *`@&? Hw  ?H`$ `` "`$$ "`"" €&xl㿘 D D@" ` " "O 8"*@"㿐 @N?&`?Ԗ E<"Nޒ !@ &` b "  \  &` `@Ȓ`  \:`` &`` @ ' ,' 0'  4 '  8  ڒ ' 8 "'Bz' '@?㿐 @ @@'@   ?ꀎ3?ӈ@P @lR >H/`$` `% D$`H/`$` `% D$`2&` @ȞDH`D@    @?% "`$D$@$`$``&P   @섞 2?  @셞`,@h ` &`` b "   &`` `@`  `\`=` "`,H/`$``$D$`$@"$D  "O?N'`0&' `4 "' `\ "@`$`\$``8 ߒ`\ E`p @2 ; $0 `8 Ao' H/`$``$D$`$@"$D 4 @ݞ(㿘 ``$  @ "€6 "`  ``* ` ` 4 "€ 0"@  @ s@2%? P l, D; ?"0 (  D D" 2\D; ?"0?㿘``8`"bPbP`` `  `D`D@2 Ab` 2`P`( " `P`l" '4!㿘 t  8L ! l P" '"0 㿈<c@ِ  +<gaȑ,@ M<#"@ 0   "`#\"耢  (   #`"耢 "#d  #d @׭ "` ,@" `@`@ᙔ"`! @?,@"?   ,@ @  @4 $ 2"aȐ '$@&&@ & L@L@L=@LF@Lpԋ@   ``"`<gb!Ą"b"!ā   ``"`<gb!Ą"b"!ā㿈<c` 2  <g$c`!Ȓ <*` "`#" 2#"`a*`<g!Ȓ *`@ `<\"耢 "   "  "@(  " 2 #"  2""\a*`\?m#\ "!#\ D D@ `QP<8 "1<+ <@  ``` ` ` `     "  2" 2\#" \2@<$" `t 22b 2c\"b c\28 #\ #\?  ?#\$ <g!'' *` P`" 2I  D D " @ "?  8 3H`` `?"`""""`"H/`"`'""'" 28 2"a*`0  @l9J Ho`耢   @?'"' @ ` ```ۂp$c` "c<*` "   c<( <X@ 2  " "@ "  㿘  ?* 2  &?Ԁ`<?Ր &   5n  8,"c$# ?㿘  < "c* a4@  D   T  )<KӐ!@ "  " @" @@"$""@ , t0  @Ϟ8 H`@@  ` ?$`"`$@"""ۂp0  @觞8 H`@   ?$"`$"""ۂp" H!" 2"耢 " @$"&  @ < P <YG 04ڐ 㿘 <"x`"t c`* @`0btt2` 4"tt?`2bt  㿘@  ` \@ !! `2"t-?"t` ` "`$? !$"x ` $"x "c< *` `  bt  ?` `2bt$"t`$"x 㿘@  "!"| "`?ꀢ \@ !! `2` ?`"|`t "x   2@ ""|"`""t"`"x"` 㿐"c'<`\''഑,@ ΂`p"t2 " @硞" ``"&`@&`&` "€2 @ 8H`@ "'"@ ! @ 4@D @|`p @w?7U?G!H/`  ` 2"`  @O `p @G`>7%\>%< @ D!H/`  ` 2"` ``@&`&` `x@H`&` &&`&@&"@"€ @0 28"t`p @?6ʐ?Á㿘"c   <a4*` @Ğ<*`   `p 7" "t"{ "xv`""$"P@o  @椞``p 6 @擞`2""$"P@K  " @``"$`@$`$` "€ "c1  4@4-?``"<@<#$`$`  @`x@f DH`$``` "`$@$`"`""€`\ " "$"P@ @N  `<!4 @@``<!G #` `p @16 @'6㿘"c< *` " "t"  "x" "$"P@ 㿘`@` r??#@2m?` ""| "c?ꀤ`\@ !! `2"tQ?""t o 2~  2"t@?ɒ& 8"x ,& < & @@E& D  \\ & H & \& <a4`71   p @奞2?5?`  @冞 `Ɩ @㿐 ` `@@?Ӑ7 2&`8 \6 ` &` & `8 @ ' 2 8 " D"&` ,' 0'  48' ⌀  42  @:  @6 "㿘  )   6  `)&  &"㿘   p @4㿐/` 2  2"k?ɐ€ ' DH`$ `` "`$$ "`""€ 0F 8`  \`   $ \$ <b,4    4`$@4`$` $``@K  DH`$ `` "`$$ "`" \"€ @&"" @䠞 㿘 $   ;?Ʉ @~ @ܳ $$ $ $ `p @r$"c<`* @  `8"t"" 2"t 2"J?À &"T  >" @\?㿘 $@  ? 3В  &``\ $ 8 $``$`\ $`<b3 $  $4 $$ $ 4 $  @@ڲ  8 b @㿘  <". a"@  ?Ɂ㿘<a. @"@(㿘<!.   `,@( 0  ?  ?㿈<`@{<`  ,`@ "$`)< @ "c"t"x#\ P #`"#d"@a#h , @  @4 $ 2 @``ّ,` '$&&@ & 㿘<,Ő X< !@kє <c`" 0 D D  h h h h h h h h h h h ` ` ` ` h h h h h h h h㿘 g , c   $ \" |" @ & \& <d @2h`X 4@@  t4 @ x4 A?p``9=`    \ (  & \ &  +?<#& & @ x@͞DH`& `` "`&& "`"t  € \   p @ⷞ2 㿘` @?  `"r?`  l?"```;b*` 2`Z`?`T [?<! @w`Z ` /1  E?`Z   ?@$ $ $ ` "  `Z"$ `Z" $   \  $ \$ <d1`3ݔ4 t$ \ $ l`P  ?΂ᜄ @I< p @@2ᜄ @6㿘 g ,   6 ,& `X4  t4  g, `4, $ `؀€ 8, ` "&@` " g  $ \" |" @ & \& <e h1^@ 2 @   \" @"& \& @ x4 A?p``8,`    \ (  & \ &  +?<#& & @ x@἞DH`& `` "`&& "`"t  € \   p @ᦞ1 㿐`@?  2`t    8? :b 2T x? "`Z`T<n?؂! @_`Z` ` @ / Wa`Z `   $ $ $ ` ?'` T ` $ \$ + p  \  $ \$ <e0`2'4 t$ \$ l` p?'`P` a @;0 p @a0a @ 㿘 P  < @ <-o0!@c"@R&"ԁ㿘  T< h."tJ` 9 "t* @?"@&  , t$"  D @՞0 H` D@    ?& "`$ D"""ۂp @ < P  <!@<f`dT$"$"ܐ"?$"0- 㿘"tJ` ""t99 "t* "t6 2"t"`` "t`4" `P 2&"P"@0" 9 "t"t *` 㿈 ?` @{90/ ? 㿘  @ "`?ꀢ " `9* 2`?퀢" 㿘\@ !! `2 M?* 2  `  C?Ԣ &  ,  ":?, .<V  ` & < l& /! U  $$"t@/  "t<d4 ,, )4 c"V 2"t"t<c#"`"t`" "t28"t"t* < h. ,X?Ɂ㿐V     &`@2O "% \$`` &``1 ' $b $b@  `@> , "' \'2ے㿘 ?Ӑ 6@bt8`  @Ȯ` `@׿  & 㿘 ?Ӑ 6@t`&`6`t8`  ` X6` oh.` @ o .` 6` & 㿘` `00``? 0 `? 0 # @ʐ 0 !"!0" H`"@0 "`?""eee*e(@ "`H`@!`!*@(@ " ` p"?<L"h @} @:  @@Ԑ㿐 #? }<j"|@ ?&T@  @k@㿘@& (`& ,` t& 0` & t`& 4@ @t 2& H<k"& H  (`  . `* `" t<k ( " H*` ( " 㿘  (  <  0Ln#?& & H<"`< Lb#0@ <k<n 8& H"& H&  & p `@ "㿘 <"`< #HL? `   `6    < L,#x <k#(& H? & ??b 2  <k`"& H& p <L #<m  & H 2& <L#?& & H㿘<"` < #K <l 8 `+& H (*`  *   tb@ *` & 8<Kڐ  t` <k ` 2  <k  ><k#& H@k 0& & H㿘 <"` <  @K  (<l!& H*@ *`    8$ $ $ p$ l 8@ $ t$ $ $ x (*@ *` @ `<K h?&  ,@ < K & & H㿘  ` <l``<l"<l"|& H 8  <l"|& H ` @)/& p㿘<"` <  KO <l "`& H    `@3"㿘<"` <  K/ <l #`& H@ (*  * @`@& H㿘  <"` < !K `<m"D& H`= `24& <i!*` €<m 5& H" 2  <l 8 <l4 8!&& H  <l"|& H  8a<n!x& H<l"& H `  "` 2  < !0JƔ & & H㿘   @  <"`3< J!P/   4`< !xJ $<"`< J! 62 2   ? L ?< !J ?& 4& H  4 82 8<k"(& H 2 <l!`   ``<l"| <l 8!<n!x & H<l"& H ` "`& 㿘 ( *  * @ `<"`< "J=    <l"& H ` C"` <J*"(?& ;& H@Ґ 6 ` 2  !   t  > b < J"X t<l > . >& t& H& H 0Ā & b < "xI 㿘<"`< I"@ &<n  & H& ` `@P" 㿘<"`< "I  <k?& & H"& H㿘 `  @ # В # # #`, #`0 # ( #@ 㿘<na@)" H㿘   & <l"4& H =`1%<i"*` € 2  <l8 <l28!& H  <l"|& H@  <n!x & H 2  <!0IX & & H㿘  t   <"IHl< Q ?  <#I9;<?`0<i#L*` € = ,?. =<b < I#0@<n_ 8 < ?. <<b "<l< I #`<lN <I#<<#I?<"`< #H& 9& H@V 2<H <  * < HHݒ<"`< HՐ x `$ "$ <`2  <Hɐ Ȓ?&  & H<H  <<l . <& H (``p" `k c`l @`  '''''''쀢&'<`   "`` '` @" @ ''  `@ `""`  D !D!D∀ <!Hh !???<!0 ?<@2?0   ?ǐ!0HF ( E?ǐ @'''''''쀧 '#<`  ' ' "@''   ""  D !Dd @!Db <!XG㿘#``N 8`, 4 G3<a@ <@ B4 @@@Ò8, a@* 2 @& <<"`".& 8a@<" *`  4! 8+ GƖ!& 82& 84  (!, <@* 2 @& <<"`"& 8@<" *`  4! 8+ G& 8㿘V    *   & ` :&  *   &  `  :&  & 2 <Gu"!&  * ?`6   㿘  & @B㿘#<X` $`!`?1$` Ă & @֑@  H@ ˒? && #" !#" !#" #" Ȑ `6b`E$`  @㿘<"`<"0G` @X@㿘  `@<"``@< bX `@`  F) @@@`" ?& @ `X& p@  0@$@ ?`0@` y@>@*@$@  $@ $@ b " < F" ``  !<X `0$ <!@ Đ Ȓ@ $@ 5y@ ?K$  6 <"< "F +6b `@< bȀ `@`  Fm  $@ @` <q`& p`X@  ?$?$ @* $@@!?& @ ǐ`X㿘 ` * " @  X㿘 H/` H <`  Ѐ d`F" @ 2`<"`<#F  @  ̀ " 㿘`̐<"`"$ < #@E$ `  &`@ H@!<" ""<Eِ#`"쀥 2"<EҐ#G 8 <#Eʒ  'b 8  20`\?`4`<#E%} " < EȀ4Đt@C*``&"@ %'ڐ 866 !㿐<"`<E}! @ ?@`'?'@ @ @*@$@ $@@>  "@ < (EU@@''  @$@ @ @ ܐ $@ @@ 2*@   * *  $@ $@  2< P E!  @  @"@ @`) " 8 +< `E@@''   $@@@$@$@! @ X @Ȁ $̐" 8 t+< `D̔ Đ@ $ @@@  $@ $@@Ȁ@  @ 0  !<X<D !<X  @`$  ?$ @ ' 05" <"8`'< @ @'' Dx 0 䰦 @ $@   @@ <@ D\!@ @㿘   <!@"& ""@<"`<!DA@  @"` " 㿘!<X `$  ?$ 㿘 <"`<D!'<X/<?#`   %  " "@$" ?'$b <!Cm   `  ͤ3W  㿘#<b <C͐!"쀤 '<"CŒ* 8@2$ 8fb <"(Cb <  (bP `  t * ) C: 84F !㿘"쀤`G!<" <"C" <@ (bP @`  t * ) Cq: ( "  8 @ @җ2 8 @``@`$@@@֐`X 80 83 !㿘"쀢<  6   l P@, $ @8 &  @]2 8H/` `@`$@@t  83 !㿘"쀢<  6   l P@, $ @8 &  @2 8H/` `@`$@@3  83u !㿘  ? <"` < "<"<"B ?& @ & p㿘 !<X  $ %Ȑ@ `1 ?$ H/`@<"`<"B| ?& & p`@ @ 0  @`$@$䁌  @@ `?㿘 %@ ,*H/`$@ @`@ @ !<X  0$ <!@ĐȐ@@ 1 $@  ?$ 㿘 <"`@< # B` @?&  @`2 ?&     `p?` "@U @㿘 @@  ??  )< @)?  Pl , `p(@ & !@2``pA?0`p ;$`<"`"  A#@ 2? ɠ?@ @@  3`؀ /?-& H/` `@`& p @ 0<"`"`< A{#p`<u& p@`@ 㿘 <"`< Ad#  *@$ ؐ`H& p @ 㿘  ` 8 <b  < # 4AE 8<X `" @(  " p& p b?& <A-#А?&  P @M $b <  A  㿘 `  $? !   4 8@? h$ h" 4$ 4@ &  h @/0?& 㿘#<a  <\b@* $a <"`<  (a @Ք& `$ ` $ `$ `$ `$ a `$ А $ $ $ $a  $a 㿘 Z` `& @ <b <  P@!<X  $ h$`4$h@$4 ?$ 㿘  ` 8   ?& <b  <  p 4@{ 8<X` "` h`  `Ԓ$ h$`& 0?& $ <  @^ `2 <>V Ё㿘 `  & @Ǖ <b <  P@A<X` "``h$ $`h`?"`㿘` @ !0p@ 㿘& & &@Ħ& @Ģ& 6 . 㿘<"` <` <!<!@ !! m  ! r @E`&  & $ `? & ( **` & ,& 0&  & & 8!& 8<!@& <& & &  & & & & * &  0 &<p" ؒb@& <& !& L<!(& D<!8& T<!H& \<!X l& H& @& P& X & d& ` `"`Ԕ" & h &"`b <!h?@㿘  `@?<X` "`"`& a& 0a`&<r<t \cȂ`"" @Κ&<t<t<t aĂ`""" @Μ&&    # @  㿀<"` < !<!<! ?2    䒒 6\<!?# .䀊$ !! `! @^ 7# 7``  ? ? 47ꀦ  <!>   㿘<"`<>"   Ȑ 㿘!   & @R @@P H@N P@L X!/p #㿘 4 8@:  @$ P!/a # 㿘<"`<"0>ҐI!<X  $  Ȑ `- e$  㿘H/` @& @   <"`@< >t"㿘H/` ! |@ p<"`@* < ">P*`<{& @!,& @<!@ p X- 㿘H/``$W $<>+#<b @<`$` # `` <"X<"` < <"X"`>  4?`t `2@&@&` &" "@&`&@`2@&@&`&" "@&`&@&`$<"`@<`  #H  <"X<"` =ڔ 㿘 $ 5H/` $$ "@"  ""& && $<"`@< #p<"X<"`= 㿘<!\`2<<= <!D.9 #㿘<"`@<`   ( 2<<"X<"`<!@=r `t `|`<=i P0 @2 `$@&`|` @̓`$U #<=U#"`@<`$` # `` <"X<"` < <"X"`=8 3?`t `2@&@&` &" "@&`&@`2@&@&`&" "@&`&@&`$" @<`  #H  <"X<"` = <#<"&` ` @A`p`&`D" @*` <`"<*<{&`@!,&`@<!@`p`X+ 㿘H/`C 㿘H/`.@@ 㿘<"`@< <!8?& @& p㿘 H/`<"`@ <<!@a`< <  <#@<<{ ?@ $b0 | <  # ∂ @Ӟ l)4 #∀ @"<8! 2$  x  x㿘H/` x ? & x |@<b @  <<!@a`< 8I  <#@<8A ?@$b0 | < 860 b @< 8*"< $!(& @&& p"$ x "@"  ""& && $b @< #p<"X<"`7  x  | & | | p* & |<7#b  @ t`q u( $U #<7Ր#b`@< $` # `` <"X<"` < <"X"`7 3?`(`2@&& $(" "@& & $`2@&& $(" "@& && $b @<  #H  <"X<"` 7 <#7~&  @<!D(! # b @ƶ l( #b @<7c! 㿘<<"`p!8{ 㿘& & p㿐<"`@< !7? t 2 D<78!  D`" $ D@  X`   @< 7 "&R H`@Ho`    @= t ` " D @< 6!<!\`@ 2 < 6"@Z'Ho` l " h'$ l` !   &G! !H` `2"` @< 6"0 ` 2  "   @" t< 6"P t>!$ t$ $ H R D @< "h6~  L`"# @ H "  t!<  " 8 8 "3 D@.$ 8` 6Z" @H㿘<!``<6M"0 |  <6D"?& |  @r@'?㿘 <"`@<6)")<E+< " $`<6#?@$O∀# "@"  ""$ $$ $∀ @< #p<"X<"`5 ` !%a !!@Ho`a( 2 x`∀ @<5Ő#8㿘` `  !<'<)<|  " @(X50$`@!h @מ `" @<5#x1<"x`   !$ސ !`"Ր 㿘<"x<|0ah @㿘 @<ya& h& L& X& \& d& & t @@& t  . >. =. <<$<!@<& #& `"$& & "`#!@ @T<"`@< #`<#<#51 㿘i 0 < 2#5  @'睐㿘<"`@< 5  <#@<4 ?@n$b0 ` "` "<" "!@& & H/`b @< 4ސ" $& @#& p "@"  ""& && $b @< #p<"X<"`4  | * & |  X   b @< 4"#א  " 4 4 " 8@ѐ 8 "  & 8  " t&  t & b @< 4~ X P`" t@ t & t0 P`@㿘H/`<!0   @  `@@  < $ b @  <<!@a`< 4A  <#@<49 ?@$b0 | < 4.0 b @< 4""< $!($ @&$ p"$ x "@"  ""$ $$ $b @< #p<"X<"`3  x  | $ | | p* $ |<3#b  @ t`q u( $U #<3͐#b`@< $` # `` <"X<"` < <"X"`3 3?`(`2@$$ $(" "@$ $ &`2@$$ $(" "@$ $$ $b @<  #H  <"X<"` 3~ <#3v$  @¹<!D$ # b @® l$ #b @<3[! 㿘 # <?&`  "<& L& 㿘H/`<!0 `|  `&`|  @^`p <3!#0  @Q`t"s ` v<`$(W $<3 #<b @<`$` # `` <"X<"` < <"X"`2 4?(`2@&@&`"(" "@&`&@ &`2@&@&`"(" "@&`&@&`$<"`@<`  #H  <"X<"` 2 <#2&`  @<!D#T #0 @`l#L # 㿘<"`@< p2<!@ ? " t 2   t$ !$ t$ H  㿐 !<`<$!\al @} CՐDOH/ >?"`"@堔+ 嘐*@ @ "H*o` !d!l<`@<b @ <!\21 <aX  -< @``? <! <!(`  eaXb @<2 !(  ` `Lb<aD'H`aD "'"aD!< ! !T!!(  !` `"!H` `2"`b @<1  aX 2|b @<1!<!@`<1! @&!\"= #b @<1!H 㿘<a@  %<#<  !I!@   @1qa`!  !!@  Ho`堔+ 嘐*@ @ "`㿘 <!L @k<b@!<#<<!\!18aXaX!\ `"$aX<!1, <<"aH  <<1!aX $aXal @: L @㿘<L @%<b @ !<<!\!X<0"!X "!<? Q$!X'<<!\0"('<\   b @B<0ؐ"P?aL  !!  \!`b!<%<)< @\0"p b @ 00"_!H\ bHo`堔+ 嘐*@ @ "`aL @[㿀<!@ )<0"%< $     <"X<# (,  ( t #\ #` p#h#d H#l L0f#p`2 $!/@!2@!*8@!9@!=@!@< ?x(@2?"@ < ?x(@?"@ 㿘 <!x.  `2` @&`㿘 4 @㿘 @>< @2 @& $㿘 4  <!̑*`  `Ā$ 2`*`㿘<"` <#p/ƒ *``< 2  a@@< "" 2 `*`  `@   2 4<!@ @ & $` <("@"`2`@ "`㿘`@  <!@`$@ , , @  2`4`€  $ `4@ Ò` ( @ @"@"@㿘<"`< 4/4#㿘  <b < 4`#/"  t & 4?&  4㿘<"`< 4#/  4`€㿘<"` < ` 4` 4.  4` <` 2` `@  4 "㿘`` ?` `6``   4  0F㿘  <b   4 4<`  .ђ& 4㿘  <b < 4` @ . 4 4 t  㿘  <b < 4` ` . 4 4`$€㿘  <b < 4`  .y 4 4` €& 㿘<"` < ` 4` 4.d  4 ? # @6  4   㿘<"`< .F  8 <!c   & 4& (& ,& @0 㿘<"`<!.(=㿘 ]  2` 2` 2`  㿘 "@`"@`"@``"@?" ?㿘` <!0a <!P- 0`` ?㿘<"`<!-ܒ  8 #p<a ! & & (& ,& 4֐0 㿘<"`<!-Ӑ6㿘<"`<!- 8  - 6 @ 6 <c6 6 6 6 !6  4  6  6  6  6    2 <* 2@ 㿘<"` <.`."2`-k2 t 8 <  6 6 6 6 6 6 6 $ 4 㿘ϐ`@2(  20   2+  2& 4  6    @  `     2 ?8`?㿘   4<&@a@``@ d&@`D`&@`@`H  ?@ `"  "&@`&@&@`&@`?#@`  @&@``@ 2&@ &@: ? #&&@`&@``4? ?0 "` 㿘@```<"P@a`<"p, 0` `  2` ,`8& ,*`@㿘@ !@  $s   $ @ِ & &  `& & & &  &  @ 㿘<"b< ",p      @  <",_ @   @h so㿘r   &6` & <& & & & & &   㿘sU&㿘!`r  &?@v!``r  $!L`r  $!P`ΐ t ` @'$   @㿘 ʐ t!P "!Ls!L ss w㿐 <"b <``"<#<#. +ٗ2. !   2 ? ` , ` 4@@ * 耦Ho`堔+ 嘐*@ @ "`㿐`<h `" '<h<ha Ԗ"@`&a ` $ a"@`&a  $ 2 &a8&a<&a@  `?# # aH  aT   <h!'@: <<h!@ 2< @ <` ӑ,`@Ϋ-  "<&` &`$ ` "` $@ ``$ $  $aL@j@gaP `+<`aL <aLaP$@ 2&@!aaP <"b<*# <h!$@"b<*#@ € <@ "  ?$@: $  aP  <@]<"b<*#`@ <#* << *# ` "`<h "a "?a"@`&a  $ a"@`&a  $ a"@`&aA <"b<*# ` "`a "? "@ ` $ @$ *v  <h` "`5<*k ( <h` "` "@ ` $ $ ``"@ $  $ ``"` $  $ <*K H <h` "` *B h <h` "` "@ ` $ i$ 㿘 @ ` <*&  $  <"aJ< * 0E $ . $@ )<"a< !*  "@"  @"$@ $ $<!@) $  @!\ #0"a< )!p``2@&& $`" "@& & $ . $㿘  <"a<"X)Ȓ!\r #p  @ '<`@   @?'''''D  !Dܔ!D∀! <`"x@)#\㿐 D !Db$ !Dx` $``  @` '''''''D!D͖ @!D<"a<`"`)a@㿘"쀤 <"a  $<"ؙ3 )N `$  8 !㿐        P `\` < & & & &!D6 & p` @6 `   @m&  `"`` "``<X "` ""  ?$  `<)!$ $$ @ , $ ` < < $ @ <"a< (!?Z$􀢿*<b! <#(ݒ <X` "`  $  <(А!$ $$ @ , $ ` b b $ @,b#!<X` "`  "$  `<(!$ $$ @ , $ ` < < $ @ <"a< (!e?$?㿘  !*` $  <$ ’?? <0"  <h<<"b؆" ," ( 㿘<"a< (#0(a ( "쀢<#`(V0  `" 8 !㿘<"a< (#"(?"쀢<#`(80 $ `@*$ 8ے !㿘 ( <ݐ0"a<"#("쀦  `& x  <"a<#(  < ' 0u!< 0' 6  € '< ' P `  '!c R<  x` '   '!O ><  ' 07ꀢ#!@  <  #\'∀! #< 3ޢ`' @ $  "$" \  `` "`㿐`` <"a  < ! $3 'm  $ @I  "& <U<X " $ `, $ ?$  `   $ @ !< 'F"`  *8 "@ ' '  ? < 8`$ <  < 8'"!H@   *@$ 8!<'!h ? 8 2!<!'<X` "`  "$  `<&!$ $$ @ , $ `   $ @ !< &!`?   !  <!&В $$<A 8 H!<!&a<X``  >  $aD$a$a$`$`$`p$ 8$ <#   "$  `<&!$ $$ @ , $ `   $ @ !< &!S` ?`h$``  d"` ?23 !<&p"<X` "`  "$  `<&b!$ $$ @ , $ `   $ @ !< &K!`?0$`< "8&@ <X` "`  $  <&3!$ $$ @ , $ `   $ @ !< &!`?$`㿘  *@ ""#<E!㿘<<! c& (& , (  <"a<%"`<"8$""a<%"<<b#4$"$"& <& 8 㿐''<"a<"%є` <"%ʒa\` aX@@ <#%`t`@` @`@\ @`<X? `"  `"     "@"  ""$ $` ?$`!< !%  $ , $  &` @0e`2@&@&`&" "@&`&@ !Ho`a\ "aX'&a\``$`H` `2"`` $``  @@`"@"  "&&`&@`$`!<#@% r?p?`$`!< #`%  (@!<#% ?2/`` "P?`p "&`&`p!< $`4&`  @26? $  !<$Ԑ"8 k'?aH$@ *@ * *  `*@&aH `Ĕa?&`&`&a4"@a` &a0&a&a "  & 㿘<"a< $# `) p "& & p!< $ & ` @ `$  !<$v"8` k㿘 `2  p<<#c$e#[K? <& p"a< $W `,@ `, p "& & p<"a< $> & ` @X `$ <"a<$&"8@` k? 㿘<"a<#$  Djv   D?&< @L`$"& & "& 0"& & 4V` }&&  2<#   "c *& 6`j$"  & $`!<  H#ɒ㿐<"a  < x#``<# ;?ꀦ`   ( 0'     '` (€  '@ "n    b!< #y 㿘<"a<!#k   0"" 4""      ` @2 $ " $`   "@"  ""& & $  . $`<R jQ0#1! 㿈<"a<!X#& 77'Y㿘<h"<h&@!&   & & <"`<!# <!,  2& (<h!& <* " ?  <*  㿘 ` ? "`<h"?&@   & <"`<"Đ!<h!.&`& ` & <"`<"!<h!&!H @<!#&!H6 06 ,6 ."&! "!"@`&! "㿘    (<hV&@0 @L H/ 6 6  = 9 @` 0.``0@`@ .``< .`c6'(<h## !H "!H  ! !  ! ! <h&㿈``,  `8''''<"`  < !``, " ` 2`  `<7 0$@&` ?&  @` "` &    H<0 ` * `<t&` ?& & HX'''7<"`  !< ."!ט .Ȓ@@y ? $?$?$? 'ĒԸ  ?㿘<"`  < "8 ! 8 6 8 & H`2 ?& & H2 " *@$  <h!<"  <."h3 !` 7'<"@(   ." <!s"? ?'7  'Ȑ"? ''Ԓ[ " <#!X㿘b  o 6`"<p % 2 ␐0    & ?㿘<"`  <#(!& &@`&@`&@ `&@ `&@$ p$  ` 2@ "_D_D_l_l__l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_l_D_D㿘<"`<  А#<  & H& `2& p㿘 <"` < #  < #`!& H (* `* @`  t,` & 8?&  $ $ $ p$ l 8<@$ $ t$ Ȕ$ x& H㿘<"` <     <# & H <" $ p$ & H㿘<"`"<<  j (<"X& H=㿘   <b  <  H U  << #`& H`= & @`D@ 2  <  x 6  @z04`2<#*` €؅ 2 <"& H#&  2 ?& `@ @D <<        袒%܁㿘  <b <   ߘ& H   `?& ` @# _ `㿈  ''''<"`< Ő!  @` ݖ  b 0< ! 0+Q 2b < !P @ޞ`??& ٔ <`$ Hb < ! ; 㿘<b%     <h<h<h<h<h<h!<h#<h%<h'<h)<h<h<h1<h3<h &!&a b"!"a""#!#a$!$b$$%!㿘@&   ?"?`@@@`  㿘  @ܒ ? ?"`"@ 㿘@А ?&&@㿘@  2&`?@`?.&@㿘.``?%< ?  "@k (?ސ0 @@"@`㿘.`  @" @   & ?`4 㿘!<" <#x9 $"㿘!<" 9$"㿀@`"' `' cD; @D b <4"h`~`` ` 2`r`*`  @,?А  N*@ *`ВД @ N  <4"h ` `N?ꀦ` <4"h `   ` 2# 21-D; @  ,? <a@ΐ4 $D @@$` @D  ,@ "'B>㿘@<`bX`` @``<` bp`@` )-<` *@`@`@` @ %< `@``@w`@   , `*`  &@'  &&@ '㿐`<@bX`` @M```<`  `b@A#\`  (-<`*@  ` @.  @  %<`@$ `@ `  - ` *` &@'  &&@ '㿘@<<"d"<<"G<#В 4<`" ," 0㿘<#4ː㿘@ <"d"<<"(<#В 4o<aD" ," 0㿘<#4㿘<"d<"!<#Ѐ  <"4Q 2$#K㿘<"d<#<cЀ <"cА"4 B{D{D{{{D{D{D{D{D{{{{{{{{{D{D{{{{{{{{{{{{{{{{D{D{{{{{{{{㿘 H/`  @  @ &   & @  㿐<ib''H`b "'"b,"%<)<#<*  !H/`<    @"`$`% ``䀢@  @? $` "@ 2`  %<`܀ H/``"`܁     €"` 2  \ H` `2"`! * 2   :`* (<  ` *    * 2 `:(* < b@  ( "@:((< "  ( *"㿈 ' '''D;@ ?@    " 㿈D;@ ?@     쀢` ? $ $ 㿘. 6 . * <lbT*  j@  "k@?0 Ȑ 㿘` 2 `! `0`"!2`` ` `@? `@?`02``O?`H 2` * 2  `@:  ?* 2` <:`!D@ ` `"@ H ( <X 8  `" "  (` X  X&`4H/``<l*`2`2`*` *  *   ` @ `(`` @"`(   @  &`0$  @| 0`"0` 8 `4 2`0 `0`2`0 ":0`* 3  2 0`@:0 03 @  2 `@:  * `` ` 0 2000 20&`0"0`0`<` 8 `0`4? &`4?`P`0`2``  ` ` `2  Ѐ     㿐2` !<. ~ @=!@`4`* @*`` ")`< `& p!<} @*` 2} < * <  #\N `` <0`<0   2;<aD`h  "`h   - U<aD`l "`l!$  +2<`<h2b* @`  * @<i2b* @`  * @H`<l*`2`2`*` *   *   ` @ `3?   ' +. * *   2" H<L @{2tHo` # "H`b`m^< @*` €. * * ` @@  `0`"K `0 8 4 20 02    `," <`#`,@#``0`"`0<` 8 `0`4? "`4P`0`2``0ł`` 2 $ 2 `@2 `@2 8 `,(  $$@ `@ 4`4@&#`4(?`,<i"`<,"#`, #`#` #`0  Q#`02 `(8`4 "`($$ "`(` #``(&<`#`(`4$#` #`#`#`4#``0`<` 8 `0`4? "`4kP`0`2`G0`D ` =`$ 9`@4`@/`*,`(  $$@ @ ``44@& 4`(?,<i"`<`," ,` #  `0#@ 0 @f ( c @X08 26`0`"2``+2 @``@"@ " ߀`$ ۀ ?`,``$$ "`,` #``<< ǒ,`b" <*  <# " ? 䀢@" b @? #  "@2` ` . 2G.  * #`#`#`#`#` #`$*  #` #`, #`$R#`(0@€ `㿘` " ` *2  2 ,* <l* a !<  <!<!@{, Ru !, `$ * @`2 @%  `"` `2P` 2`  @2`  $ `` ` 2 @ ` 8<`@   W`  !<` z! /  @C,` @4 2` 2 `@ `ڑ2 `@,`0(!  !<` z!ޔ @,``` @ @`@ € `@,`㿘`$` `!<z"``( ) `2 `@  @ $`$``(  <$`( @$ <€`(   `2 @ $`<$`"P $ $`  㿘 $` @ ?<i&"# #B@㿘<l!b<x  0$bȁ㿘` @0@ 㿘`   d@@ .`  `? < `"2  `,,8 <2`ᔅ( ` (#:  <*( 㿐<l!"Ȁ(2  "(<"  a  2b<"b`0"b ``*` *  <(* b <l < 2a* @`$ * @"$ ` @"`@A  `= @@x* @ِ@`&`` * ` <"<l <lH*/  %@4  e ` @  @ P^ ~  l'` !`     ϔ`  y ` `U~ 0Q $ `  <#( ?~` ͒   @L ~  ( ~Y "%~%@ zH/ <lab  !<x"H/ <labȐ %`0m"b<l㿐/ <ʐ#@O  <#pG @D @  :      <a0>  & ("a0& T  `2D<#'  !D   L@ `   @`!D <|#ذ 㿘  ?t?    *@  & |  ?<Z 0p "< @   w *6 6& @5` d 8`2 <? 80U 6 xT& ?逢"& 2 ; $ #`$ <"<@"@D"D "  "  X/"X x & `* h  2 I   .``& 2 S  B.`2 K `"& @ "@& & & xq㿘 ` <!$*` "&  ` @ " &  `"& @& 㿘` <!$.`  €  $` `@㿘  2 2? $ -?<" @@ 2 wE  & x& Ր& & 6 & & &  d@̒  $@ɒ @<**`" .`2 {2    "  @\@ !! `2 P?  2DJ?;@ h@ڔ   9?  |`<!$.`@ +?O h x @& @X $@`& @`& & & & Ȕ @ d6    `J? F?@Hh 'h $ 3  * 7l @ `3  *   'p7t'x@'   '|\@ !! ` d '@tD;@ h@Q    ?㿘 "f? *. 2 2  < p Z? . T?*  * <(b      7` "`"`-`   0Ԓ , ' k" ?"?D;  <* `*@ * &0  ? ?㿘 2 *,?6  < B #? . ?*  <(b*   `<!$*` `"  ``" @  &  㿘 "6  *. 2 2  <  *  4& wǐ . *  <(* b  4 <  <a$* @ &  `"@<$(@""@? 㿘 <(?"&`)<. !$ 2   @$ $  ̀* !$" @y!@< * 02(2 㿘. 2  <* @ 4( 1<*!<!(!puS@*㿘/ &(< ጅ(ψ`   .@* <``/ ? &( (` "&@##/ &( (`@` /  ( !(1< .`/ & 㿘 Ā " `S &  Ԣ @  " `G $  Ԣ`@ 㿘<*2 2 a* @ *  & x 2`z #?$*J@"@ !<!t@  `F & <ې!@Y$`  & !<t!ؒ͐ zG㿘. "* "<* a Ԁ   =   `@  @ )<`  @ `!0z `@  _ p$Ġ ` "   @"  `<j"(@ ) $)* !<"xt/2  T0<  )* !<"t2 G0/  < . <`"@ !"    !<( . !@$(<?`*  "@)* !<"s2 0  㿐. "* "<* a <\@ $ Ԁ^-<+<` S@`wsɐ4 x <'`$@g`/*`@ @b|   @ 2  xܒ `(  y   J` to  ,yH4 utwn scPԨ ` H-`"<*  a"*  @   `? "  `̀? < @ 6 - @2  {`@ `<-!@  <cx@2=@`}?-`"* "* ! ϒ @   @*   `  A`@ &* "!ԑ*  @ -`   $, $, t`v @<!%_ 28?&* a@"!* $€ $0"@ !<w#?ꀢ  "<*-`P* *#@< #!" 㿘`-<. "* "* ```. "* "* `@<ʐ#P?  € D?tz`*`*vt ``"%* "* ```z`@ @.  . `  6`@`%<*<* P%@ "+`" *  < a  "`$# 㿘. "<* " a* @ U .` 4  <4 *`! ` <`* @`<<# " .  (  B?. "* "!* *` * 4&` 2 ^` ,`2 2 *  `*` &` 2?`(€  !<< ? $!< ~5`  㿘\@ !! `" ? *  `<!*` ` ` 4?b]"\baxa"%.g?0ݐa%a'հ?ꀢ:( b^(b`?0ǐbb3bc8?02`:`*  ` /   D; p*<* aP* `@&g sD2  *u>  0<! c" D; M0<a #@&G wD;D   . ? g  . ? [ <** aP* `@ & : 6 ? E  *@ <*!P*` & ? "3 01@ !! `2D$?;   ? " *?T 0=2 D@  ;@?&0?  +<( ( a(`@ "@㿘 *r , "* <"* " 㿘 <  +*`" * " * `?㿘 <  +*`" * " * `)?㿘 < @. "<* a"* `@` `< X {?㿘. <"*  "a* `@ 2 3 @`` ```@€ `" ` . `. @€ "* "጑* @ 2  㿘< . 㿘  @\ В #㿈 R ''쀦 ' @^ & <&&  &    @%>0S 㿈 '''& ` & <``   <    ڐ <  ڒ @㿘: !d!l<`@ra8 ?""&   @Ǟ Ho` 'IHo`   ; H*/   @ƞ`@ <`܀ H/``"`܁    €"` 2 0H*/   @Z 㿘<a!<*#<<!!``$ ?   # # "@   "  ` <a!<k""`$`" $<<"8/b<㿘 . 6  <(* !" <* a" * @`2`$<!(.`  €2`㿘<aX@<a !<,@@!p@, *?<@a<a`$ <@@wa<@a@p  ,"* "<L* `@<!<!Ȑ < @W&*`"@<*`L<!<@@Faа`@ @  /<@@@1 @ `&* <"ጕ* @ &<bL@ <!, <@<@@ ذ&* "* <! "<   `?# <@2@ @<@@x㿘>  <?!.  2?"@< " 㿘> ` ?!<!,`< " $  Ԓ @ Ĕ  `( @  㿘<!%@na: )* 5*` <* < a@5 @> < ϐ"@< ː"P!<"pm Đ< "!<"m <!@`%Ѐ $ @Ґ@ϐ@ː@ a@@> @@5sH   @ r  (  r "r< d"> !@@"@@9`* @*`@*`2` d8  d@y@ @ <<# ;` 7#`&/ 4 n#<cl 'а %Ё㿘<! Ā"S(@"N "J "E 0?  2: 2`   0 )ܡHH/  `0` `$`a`$$a$@T$:  ܨ?<ā@@@x_@Н㿘  * ?"@@>@ < c@ 0< c@㿘 >@ `6 a<!\*` €<#   *@@ * z!<# @U a @ a@ΐ4<c@ǐ/  h   HЀ   0 < c@ <c @x*`  *"  !<#""ؒԐ㿘<6 a #@`$*$ * @$"$ 4!" " <0<0(<0 <0(#а H`'D*  @*`    * ?'L''   d<b .`4 q $&  U ` `?s`* D* ’@?`#' '-?+? @ڔ  *  *@ 2 @ 2 @@ʔ  @   @     2``\@  @**` @ 2 @ 2` @  @*` @* 2 @2`   :<@  @*` @* 2 @ 2`  h@v ܔ @**` @ 2 @ 2` @f ܘ @*` @* 2 @ 2`  8E`<" @Oؖ **  3  L 2@A Ԕ @=Ԗ **  3  L 2@/ Ӓ@+ Ӏ   D  D<b  "b ` `1?# ̐ @ ?  ** 2` 2 ˒@ ˀ  ʒ@ ʀ  ɒ@ ɀ ` ````Ҧ`Y<"#?*@ D*`Ĥ  @ʒ ?#  ** 2` L2@ <$D *`  , @? * +  2L3  @ $ @?# * * 4`L2@ D<*`t ozq os㿘  * .`6`?o =w$b "@ <ؐ# `<Ґ oP0*<"@ bH+<` `0`b`՘ b $b  ` "2`"<o)< 8㿘.*   @5<@`   @ %  < @0`  #@ * *  *  *  : " ` @  &㿘  * .`?6`n 4 $$!W@n͐0)&< @ @  6``<`  " @ @& n  * <?.`'4`b'LD n' 7`'|< H4?4`<j"*` ` `* @ &!: ' ' $'"`! ! U ` `?   nZ   !<ؠ pϐ '*` 'h * @`@I ?Ԑ#'t? 'p * * @2@ 2@ !ʤ!Ƣ*` ! 'x'l-?p@$ В *  *` 2  2 K̒@ ̐Ȕ @**` @ 2 @ 2`  @Ȗ * * 3   2 @L@` %Ē@ Đ @**` @ 2 @ 2` @ߔ  @**` @ 2 @ 2` Lqh` <b- ?c <"b*;? 3?`` t@  *  *` 2  2 Ǥ` @ **  2  2 @L@  **   2  2 @~@z      @f   @^   @W  ` `<Ɛ  - @` :"@  *`@*`2`< 8 @`  "`@0   @)  2< * `2 * @  2< *`   * '|7 @* 'x , ,  @4  *  * 3  2  L k  %`x2`  <M |<F 8 U l ` `?`a<  Za?#)?'?`@  *  *` 2  2 9` @  *  *` 2  2 '<" @ **   2  2 @|  * * 2  2  <b "b <א   lQ㿘.`6`lf 2 $!< fS?6!"@!l1I !@  @@,`!< ft2 3 l/ !)<!@ @@`,` "  0  ™` $℀``<n  k 㿘.`6`k 2 `$!< f*R??j!A@8kȐ5 @  @@ ,!<!f 2 3` k %<   >  $ < ` k 㿘.`4 <4 <j", ``* @!<!P!<"e6",`2 iے  !<k $@#K@`  " # ` $k5e6!xf`<!<!`k!`O T"T6-<k7 `$4    %  ? @"@  `   j@ @{  %jא` $<N  6jʐ``c6i5㿘.`6`i jՔ + `$!R@"jk *`$j@j `$"@`M `Q jM !<"0dِD?` @7`1<5 `".jn.2 @j ܬ`$"@@``@^` @Z`" "` &"@Ҥ`"<jA<  x!<" <"X`*`  * $"-"!<ؐQ"p.`2`z ǔ  I   <}"x㿘 !<.@  * !"@ @ *`<@`*`"2`  @6.`*  .`  ` :`" @ ! * "x<b@{<b5  *@ 6+( -< `- @ؒؐ@{Ӗ&   * ܪ` (2 &@ 4㿘   "<   <#<#<#<" @  " `0<K! @.  㿘 ` "J<  <#< ><#ɒ<Đ#6   HHo`<S#Ԁ "<K <0 <0<K! @*@0 !` @*@0 (0<"*`0<"*@㿘1   "<   <#<#x<s#<" ` " `0<" `㿘 ` "<  <# <#S<N#<"*`0 <"*`0<"*`0"*`㿘<"  <b #"<A<bЖ   ?<S#Ԥ< < #"`k"<T l ` Te Vc<@~c8<@q` "<@~<``@e NԀ #<*x<` @~<@wa` =#<*a< `@~@Ȓ @{ <a   <"b   Ԁ  <<<*<#ؒ`l!#!<" "<*<!bDa#a<""< "b?㿘??@> S! o @8 M! 㿘<l!`<ؐ  @n2  2` ` @@ 0$`ԁ㿘< `< ` <!8`< !,<t"㿘?!<< !,!4흐  <a@ '$`!<*. * <*"*  <@  @ $`ΐ!4. * "!*  <` < !,<@"@=<:"`<-" x $  6 㿘. @*`<+@<* *"@ <*`@ !@  `"  :< !,< "h<-,  `L   *  ". !< !,<"L@ <  !,"З2. * $a*`@ < #%< ,<ې" ,<@֐#0L`@<*!< ,#H@  Ȑ*` < ,#h < ऐ*  6 F L`@<*@ M < / <* ऒ   @מR`   @Ϟ` !< .  `< !,<# * @<,8*   ""  ः(`@@ `( @ 㿘<- L, @ 2 q?  `   * @  ` `? !   `? , , @ .`* "<*a*  << !,<2#, `L*`   <*`  *    `? @  ` `? ,  *` *  <+<* @ "  @  @%㿘)< !,<* *` * " *  `''<-l#<-`L* `!<*!   *  +@`l*   ` !,<+*` *  <* @ " <-l<-L( ?""( @0<+*@" ? `8 2 ` 20P"`0``4㿘 !<- : <$ l*a, l ?<#0!  l<- L*`@`2   l  l *` <*@   l*  @ " 㿘<!`<T#=?@ ?6?HH/ <` ! `< <  $ `<?"< `( `?㿘  *@8  *`6 :` 㿐. <- L ` @ `   * 3. <* a`(. @*`<*"@*  `@<+ *`@` !< !@ `" ?"'@^@ d@ `'!@ ` " "I㿘< !,<*,* "a*  `8<+   `  $@ , * *`@` "*  `2   * %<-*l:$?2  8*`l:`   Ң`㿘<"#1< @<H` & ""<D D㿘<a<<<""ꆐ"㿘!< !,<**@ *`"@ !*`@ `<< >  !,  !,<6 <! @ @4!<"]<a@<" $ $ 韐㿘<N"<a€㿘<-l<- L*`@`2<@d 0!@@ !<  "/$ $ v HH<$  $ HH<$2 $ 㿘<+ c` 2`< c `<%<c c  `c<"`<a<!<a @ <-l<- L*@T"HH/ H`<"!<$" %<@ %bc@   2<$"<- Xc <^ p l<-`L* <c!<#<2"  $a@$!!%b$ $a N㿘<- l<- L*`@ `2  ?0+*  # #<* l*` a€    l<"̀`  l< !, l<!0@ l L*`@ ` "`?㿘Ġ : ` <-`l<- L*  <* `!<!\<-* `|*@ <!@ `*"@  @|X $!\ `l<- L+`<"  "< !,. <: ǐ!`@r?㿘<-<* \aа '<#<* ?  <!@<$P-"T<- l*` a€ ,  <d 6 <"̀` #<-< !,<`l!@;`l<- L*@"?㿘C  ? ?㿘n ? g < b/< + ` ^ \  㿘<- l<-L*`@` 2 ! !   ` D <+l*`@`* "`<+# ` "# 1<l1<#l L*  _!,??2 l!, ?l1<l L*  `?!,  <** @*`"@*`@` @}@|ܒ#!@|ِ!<b "4   !,*` *" *@}f2 !@|! ` 8!,a* @*`"@*`@ ` @}P2 !@|!  8l<*`,    L  ,` `   `  l, *`"@: l `*`@*"`: 㿘#<-`l!<+<-#* `L@     <* `#< <`l !@*" f` 㿘<*a< `"` ` `h `㿘<*!`< !, <["<-`l<- L*@"<* !Т ``!``@ 0 0  ƀ  !< !,<5" !,<+*`@ (`@ (` @ @q<!` €   < ,<+* @(`@(``@  @Fp < ,<*+` * " a*  < <" Z < !,<-+` * " <*aH*   8 I < " aЀ`<ݐ#;<  <#  <#0  < ` <<#@N<#X<<#h<" <#x << #3<"`a `  $ ,<+*` *  *  ?2 < !, <#<a @ 0 < !, <}#<a㿘<+c   +<#-<* a,<+*` * "  ऑ*  *  <@ # <<Ƙ# "T" : M|<#l<"bc    c`1J@c  `  a,*` * " *  << `<<-!@`t<""  <!`€@l@  @H<a<*@"0㿘< !,*` * <*" *  << `(<<-!@`t<""  <*!` a,<* aШ a a,<ѐ 8 a,!<*` *  <+!*  ?2 €! @ a,<+*@ *`  *`@R``' @#<-!` a," *  <` !<<  P<!@#0 a, a, * @(`@(`@@֞!@ ` a,!Б*` *  ऑ*   @2 㿘#< a,<+*` *  * `Sl  a,i   <-`l<- L*@?" a, *@ *`@ * @ @"@ <*!*`@ `< !<*< = !< a, 7 @ !Ѐ @ a, * @(`@(`@@_0  * @(`@(`@@g㿘< !,* <** "  a*  <<- "a<  a,<+*@ *`@  *`@  a,ΐ <+#@@ a, * @(`@(`@@!<! @ ! @ a,* * @ *`@ R 4@ @Ξᘀ )!<+#@ @$`@ "#@ 0?* ! < *@<-8 l*`:`< # $ " % a,*` *  #*  @R    <<#"b  a, , :   a,@ڞT!*` * " *  << a<<-!@`t<"" f 㿘!< !,<**` * " *   << a <<-!@`t<"" I <*!` <-`l<- L*@"<* aЀ xa !,<+*@ *`  *`@R`??I !," *  << a8<<-!@`t<""  !<! @! @d" *  <<aX %<<- t@<" " !,* * " *  <`<!x !, * @(`@(`@@*@ ` !,*` * " *  << a<<-!@`t<"" ɒ !,`*` *  *   ? !,<+*` *  *   2 @㿘< !,<!`%<  <*!!< @! & @`㿘<!@%<<<"!L"HH/`#<b<""<! @ $b /<-<- l  $đ* L 2L <_" l<["<"8W<ϐ"H0R*@"   <"`<"̀ `?<*`"!<"X -< '<*#<   ) h`$<s"p a, ` @?  !<X  $  $ 0  lL*`@ ` "`}x㿘!< !,<**` * " *  << b<<-!@`t<""  <"T<"b  !,ݐ  @8㿘< !,<**` * " *  << b<<-!@`t<""  !<<-`l<- L*2`` !<"!`! @㿘'<-l<- L** <Ē`<"""ِ H/`#<b<""<! @ $b l*  ` D  `  <*ᴐ €`0 ` !<*@ ! `€  l*@  ` 㿘<P"`<M"<J#<<a@<H !L a@<" =#<-x<8#X<5#p<-`| /<-<+<\ @u*   @u*   @u* ㈦\<!P <#<X< #aT `<*!!< @#aT & @`<-l<-`L*`@ !<<*a€  #<<#<bĀ`<ܐ#<" `"< <Ґ <" `"< <Ȑ <!4 `"< < 8 <a@ H" <a@ X<!< h<l< x<< 㿘%<̀ E<H/`#<b<""<! @ $b ̀ <-< !,<s <-`l<- L*!<!@ " @ ! @<<Y @ <ϐ 㿘<+#< a,   <-l<- L*`@ `  *  "#<+ <@*` @*  * `<- "t"  " <-l<- L*`@ `  * #<+8 ,<* a`* F ,,  l::` ,<**` *"  *!*`  㿘<- l<- *`L 2  <G  J z< !,* * <*" a*  <`< ͒ <+#@ ,  ,* @*`"@*`@ ` cc`G`  @   ,<  !<a @  lL*  %"  lL*`@` `2   ` P  ~ l*`@`, * "`< ,p" R㿘<a(? !< !,<** * " *  <`<!8L !,<+* @(`@(``@  @uG㿘<ah?Ŕ <<`<""!ؒ #㿘HH/ <`  !x`<⺐!0! `< < <"@<X"a ? <- l<-`L* 2   $  ? ?$ <0<< "a㿘<! @ 㿘<! @ 㿘<!`€<,<+(( (<*<P!X43  `*` (" (>*P(3   ( (0 㿘< `'< ,<+*` *  *   `2  I#<-`H!<+@"D "@ ,*@ *`@`H`+ ,<**@ *`" `H*`@!*"`(@<! @ ,* * # `H*`@`0 <-<-`l L*@ "`4 <+`*  ?2 2  ( <(T< "!(2  <ԑ* < (㿘 !<  ! !! @!` € ! @㿘+<a(<+ "# @<+"c `   C+ +  `<- 2 8 M+ ``< < 2  ,* `@ +  `< 82 a  `" + ` * 2 + ! ` * # + "+ ##  @r , @t8 @t4#@ `! @tpa( ` !(  @ `***c *c !@$ *  `!@q+  `` #+  `` @   `!@ܑ+ 㿘<!(<-`<D? *d#!< !,<**` * " *  << a<<-!@`t<"" ; 㿘6   @ؒ  2R?. 2 1<!(-< !,<**` * " *   ` `@  82  *  `#  * @sː !( `2@@4?0<-"<`<"`<"<-bP<8<-"<# H 8"` ?"?@㿘<" <?ae<l!Ԁ< !,}< }%< ,<* @*`@!<+0 *`@@R`  ,<*@ *`@ (*`@2`@ 2`H`!0`'Ԁ # @ `Ԑ  !0 " "@ $!0# `@ "!0` `Ԁ  @:`ԁ!0! Ԁ*   "  `" "` " " ` F"`!0 B! Ԁ`>< a,N!09 '< ,<+* *bD <+   * `*   "`"` ,`*@ *` ԑ*  *` @"`"` H`y 㿘<*! `< !,*` *  <+*   `<+<!@" <+# # *@ `  2 :`   /<-@rl" c+<  ! $@rd"  " #" * : @qa0 q@p?*,<Ð!c< `"" c< `!"( c< "8 <"Hc<- $< p"`< q"x q h%a0j2%a0 " a0  #<.`+#<< &#<!<! @! @a0 <<!`€|,<a( ԓ*" *  <, 8*2" #<` &,<**@ *`"@ !*`@ `<!<!(  <K",<!( ԓ*" *  <, 8*2" $`c   !<<l"`  <-!<! @ !@!< p<,<!$"" $!$!<! @<l(`  ( `<`<``$"`: 㿘!<- p@Ȑ<a(@q@q p&& <"!0㿘<l  5<`/<-ߐ<!0`<+# ` ! p $ 0" $0!0ԣ* `<` '<+# ``2"$< !,<쮐"0<쪐"<즐#<졐#<윐#0<옐#X<#h씒$]!`<! < p&$"@ a*`    ( `]* %<)<+<J<a *    #a" ,: g#x pc b!<+0<^"# ` 2 `<U## ` -<M#*`< ,#E<+# ``@q@@qޔ@` < < ,* ` ` $`<` < !,< 0㿘<+ `  `* #` ": $ ?@ < X 0*$㿘!<l!  2` ` f@ <+ ### +`<+` "#<( ##  2 8 ?怢` < !,<Ӑ x0<( ##  2 8 ?+`(%<-@pF`Ԩ`@o, `Ԓ@p} (,p`  @ (  < "a0հ ( `p@o, !( 2< !,<+*` *  *  `" `p * (  ? @ ( @oZ* `p (!< ԰ `=" $!0  *`#( ` 82 ` "*#( ` C*( `  ?    2 `# * `#   *`&(<   `* "@ ! ` !,2` *  *( `* %(` #* 2 *$(+@ ``p;`@o #* 2  , "(@o֐$@6 $`* $(`p@o@ `"?*`"%<- <+#>  #@?*#(`#@ " *" `$ *`$( `p@o@(@@o^ !? @   2 `!< `%<-  `! %<- ` ( (`p @o~@o|`<,q @ a$ <!,@  q<! <!$  q     q   `:!`  `  ``p .  * ( `"  2 8 ?[*?X<! *c`pK"  Ԫ` 82 @8T`p $, ,`@#,<-+  * <* * Ha `,< ` <+ *K`=R:@` ` <a0*  "D",< ,<`p ?  ` "<`@!< &9<!,@2",!$`p4,<a   q < ` <<a *   @  <,?<<"$!" '!$<<!  % * @#  q  <a?<<,麐!<! @*<"<,! $!Ŕ  <<! * "<0? q  ?  * *` (" `   2 ; !$ <a < ` `#@k*  0@<!H,e0`   a<" 0!W:` `p<P!< `#!J< `"! `! `A ` !<=!<<8"< <3"(<!$/"80_ ` @1a@ <! @* @(D,<"H<`<`p: a "x0< " ` 2 `<# ` 0 <#+  *`  (* ,<"6,<"<#:` <0ݐ# `, 0<  㿘< !,<@< "aX컐 <l"Ѐ ""<<'<!<<+"#`$"< ,謐 8"Ā< ,襐 X<<"`Ԑ!4<"a$0&"<*<la!+<+ Ԁ`2$`#<`!<%c $"< ,臐 8"Ā< ,耐 X<?<"׮!4<"a$`@ <! #02  "`(<g# "    2 <]#@ 4   ̐@<c` ?, -4 <+<%c"  , ,:*  2@ `<* <+*   *  ` <#p, 0<a( - <`  h3   < ,#$!(;  ,ऑ* *  *`@ " R`*  >*R <*`" * T  $`$!(<"  <- "`H  ,Z Ԕऑ*` *  *  `"<<a"T ,<*` * " *  <` <-`t<!@"" ʒ 㿘<b`<<"C 㿘<!`<!<l! <粐# < 0 ` < 00G?< X㿘!< !,<*(* "a*  <<+<"p<+<""a##*`"@< h} !,<+* @(`@(``@  @v<ƒE ??㿘<b 㿘 " `<- <-l L*`@ ` "`l L*   2``<b<"<Đ!X??o㿘  <+<+#@  g"<* !*`. `.  *`.# . #<<*!И# @  /* # .##`#Ho`#" `#@  `. @ `/ @"@ a, #@ @ ?"@#` "  a,# @" @A $$#㿘`&`  ?`2 ?2  `5ې $`` -Đ 2`㿐<-`l<- * L  2` <0*@ "< !,<+` l#`   : @ 2   *`@ `  "` 2*` 4 lL*   2``?0L0*  "i?g?' P,  "]?&D; @  @sД P  P  ? H $ !$ ٢`P > /*? 6*$ D $   ɐ?2 ?2  `5~ $  $  !    D @ @s    ?  !  C,  w<b<<+"<" "T< a, + @ *`<*"@ *`@ `<< ђ ?  lL*   2``2? !,<+*` *  *  ? =2 %;D@@s= P  P  ? +  !`P `"    4 @   D  @s    ?   2D "㿘6   @< bȅ( @t. HƑ6  㿘` .`"<* aT & 2?  ??< ԓ.  & ? (*]@'L^@$40\@ !! `?D;   ? ?,d2 ݰ ,K2 D@  ;@Ұ?&0L  4   @  p2L!< !,<!( !,<!HbZ'LLa X@  c`@e?zb@&c@8?qg ; / /'7D @rD     }?\@ !! `&W<*2 a* g"@D; b?*<2 a* @&0X\@ !! `2*J?J8 *L2 0C =D; 7?&01<_!$? @")?<"L    @2`: : @  ` ?ꀦ L`@`"?` "?`< `   ` !!` X? X@kcL`L  D;  @q  ? L"@"(`8bJ@.bF@. bA@bE@?0bG@bI@ݰ?0bV@"c. bK@ӐbT@N?0bY@zbX@b?0bZ@??0 b@$"@f "@"@??0z"@)b@?0q "L@. "@ "H@?0a bB@ FbC@A "@ٰ?0T.* <+`*   I?  C? @r @rȐ  .?.@*`@<+<, .*`8 <@" `#@ ,Q"`   .* "<*a*    :@ 쀊?ꀤ`m\@ !! `ƒ  ?<+< bȓ* ,`,` :  2 ?   @r:?4#<* aT# "`"`"`"` "`"`< "@<,. 8 2 @ $"b"@?` <+  &?:  2 ?? "?F)"? 4 f  ?@   @??."<+* cX< !$@& & & & & & `!<h!$$!$@<,`.< 82` ԖC"@  #< !,<+*` *  *  ?< !,<+*` *  * औ  "  !,*` *  * $#X *`@ S  ,S  ,2 & "  L0.* "<*a*  < * <* "<*a*  < * <Ւ  ?  @?ّ.* <+`* X@  ?? .* <+`*   ٰ?,2 ΒӰ妒  Ͱ?,2 Ȱ* "<*a*  " 8.* "<** ~b * "<** b "@ " """ ,`"@.* "<*a*   T ("@<*`!T@ < @ij' バj'.* "<*a*  @gM Xr .* "<** 2a>  e?  @?_?.* <+* `# O6<-*` L@3'@<+*`"D@@h ? .<+* bD "'`4  /?,82 L?"%?0  ?[ \?L2   D; @nƒ    㿘<*J@   * <*! -<+<1<L * * " * Ѐ b `X*@  %b@\!xЖ < !<! <!@f X`X`ҤX <"`㿘  `*2  ` D@ , @*`@<+*` @2?X㿘 <+ *2`  `@ *` *  * @T   4 D*@  ?"?@B * 2` @ T p 4 W(㿘 *`2`  ` @`  Y . * <+* `   ??& < !,<x!& @ 㿘`2  *< !,?<i!022  @4,?<b:  <- : * `L  * 2 2   ,?<+*  `*   ` $ 2?*`* `  #<*a*  <    @oV  @oQ* * `  ? `$(2ְ?@ "`$ϰ?( * * ` ? " * * `  `" <a R * "<**   ``  @, ?2 ?2  `/: a  < ᘒ , ?2 ?2  `/&  a  < !,<߶" i  , ?2 ?2  `.֐  ?<<<"! $a"a "$* * ` + ?" $ +<!@"<?"a"* 2 G? `   a  ` 6``  6`=L*  2` 2`$0*@  "`$ @2( ` , , `" (B *`?` * * ` 2 ? 㿘6 .  2  @< !, <&"P0<, * <+*` @ 1@ 2/ "<*!<*@ (P"@ 6 @ ⭐ l <@ 2  2 <bȑ2 2   |  < ԓ,   㿐6  `  , <+*  * ` %< )<  ȑ2   ԓ,  2 |  h,  @*`@*`@    , ȑ2   ``|۰ 0Z* <ऑ*  3 3 <?"a ( Ȉ@mԞ  @mϞ   #  `0 `* 2 2  )< *` "$,` G2  ' 0`   ` C    G͞  @ 㿘HH/ !<!  $!`] ` <-< !,<<#!$!H?" l`l  "`l<- L<*`!$ l l*    lH  l*  €` l  & l?$ l  <-`L<*`!$ l l* @? l   €` l  $ l <""$ l 㿘HH/ <a? "a0T#<b  !<"<""<! @+ $"$b? 5 #<<`%<'<!<-<! * ?<<"! #! "$2 2`, a4 <- x<~ X <x x `<q  l$ l`l  "`l$ l㿘<! `   ?ިmdmn lln n n n n n m 㿘<l!`p<{  0Ʊ$`p㿘<l"l`G`2  "`(<$ Ȁ " <l  2<l< "l` <-``* a * @*  ``<! <l`2`(` @dG 0 @`@l,`( F<  <l㿘 "u? * p7!` j <ڐ"*` €\@ !! `"X? *D S P?D; <-! +  2` &0B@?D; <-!+  &032?\@ !! `2D#?;   ? " *?հ 0*2 D@  ;@?&0?㿘<a<! "@ "@ 8 2D ;@  @i@B >㿘<a$? "a$<< a   +m ! &0 $a +<< ?$<!@ $"` ?  (\'H''L'P'T@c\ DH*`  " H  !$7  `   , `" *   ,``"8 $ *,     / ,`  "  '' "@`  ,  *`#`" H`@*  '?'h ʬ .'@" .`_H ;<-.` @ `&+` " ?" `@*8 +''''@ȑ*  ` @h b8 'b8!  h"`"  //'*& 4@, ""4H*`&  / c/L    /7LT" *  /L" P* 74@)  , * ""  ) @)@4 @2@)@? @  $*.`? @ I;.  `@ 㿘 ?@1  ? 㿐< / '/` <<-<-'H0 "4'a'D3<-!<#<!a@b ` *@ $!@ * ! D*  @`+@<# `c $4+<-<a@b ` *@ %a@ * a,`  *` `۠ `$4<-"$ *@  @& `,`+<-<a@b ` *@ %a@ * a<c $   4!<#<!a@b ` *@ $!@ * ! H*  @`-@<# `c2 ~ $4+</<aḀ@b ` *@ %a@g * a,`  *` `٠ ,`$45<-+<1<a!@b ` *@ %a@A * a<c   %" $4+ %@%@@% %$@_I <-$ @*@  @'& ܠ 耤<-<-&""0"b4 㿘<-"4<-< b0&!  4#<)<'<-a!@ ` *@ $a@ *  a?# ? 4 '<+<)<-a@" ` *@ $@ *  ?#*@5 4 -?/<- #<+<)<-aa@" ` *@ $a@ *  a$ * @&a 4 ذ?&4&a&0 xtp "? 6"  .   "@! ! .  !"@!   .  !"@ #\'p<<"V! ! (lh .   " #\'h<<┘"В   tt0 lph  t l㺐<-<-b4 "0%<)<'<-!@ ` *@@ $@ *@   `?! 4`%<)<'<-!@ ` *@@ $@ *@   `?  4`%<)<'<-!@ ` *@@ $@ *@   ` 4`T?Q (<!̦ *%<+<)<-a@" ` *@@ $@ *@  @ `*`% 4` ޠ? <!̖**`"  '#\       0<# *`  /<- @%<'<Ḁ@ ` *@@ $@Y *@   @* @' `$ 4@ `.  % /  `%<'<Ḁ@ ` *@@ $@, *@   `` 4`?`f. "@ ]/   `%<'<Ḁ@ ` *@@ $@ *@   `` 4`?`6 . "@ -  `%<'<Ḁ@ ` *@@ $@ *@   ``  4`W?`   . "@   Kt<c0<<-"b0<-"b4'<#\"V !  1<@ Z0+<#4'#\.<<┘"Д   <@ǐ @A?0D   3 10 㿘<-<-"4b0  %<)<'<-!@ ` *@@ $@R *@  `?& 4`%<)<'<-!@ ` *@@ $@6 *@   `4`?%b0 %4   $ 㿐<-<<- ""0""b4 #<-@$b8 @0@b88 "4  <ἒ? ""b4@ <<  <-  * @ "*@ "<#"< !   * 0 8  #@ 㿐<< a <-"  @ $a@/a<-"  @ $a@/a<-"  @ $a@ <  <[ `*`:  <T xa<-"  @ $a@q <B <= <7 a@`$a@Wa@`$a@Na@`$a@Ea@`$a@<a@`$a@3a@`$a@*  1 a<-"  @ $a@a <-"  @ * $a@ * ? ? a@`$a@??a !<-a"  $a@ a a!<-"  $a@ a  "<  <0 " < < <!!8@!H?a<-"  @ $a@a <-"  @ * $a@* a <-"  @ * $a@* a <-"  @ * $a@y* a<-"  @ $a@ka <-"  @ * $a@\* a <-"  @ * $a@L* a<-"  @ * $a@=* <c88< !p<!Ȁ < !@o?㿘 KV  2 !!` <ԝ!)l <)lB !)p? !)h< !!$;!(c +&!$$ ! "$!(-)l!( !))h!( !%)p!( a@cV  ! @c!2  V  " y @"#!(㿘!( !  )h `@)h !)p !! @cx㿘!(  !$ `e U!@ @cS2!\14(`D; @a@@2 `"*?)@@ @` @&  @ @`Àh @b @@4  㿘!("  !$ 6 @ 㿘!(   ܀` @T  '  ! R ;D    ?#㿘D;@ @?򀠠?!@@b @@bŞ 㿘 <r" ?  =А㿘 <["@? ې 㿘!(  ؀`"!$@!$@ )l!%`.!% !)p !㿘 (?!($!V "@`*` `! &)?!   @bY`ú ! @b>  ! !`"`Րʋ@ @㿘<#x`  <#x %< @N @o$ &@@ $@㿀<#x`  +@ &` @ #x@2` #x@2!`<c @N_` @#x@ #x` @ #x@2` #x@"?`  &`  €? F?B<x`  #x #x2 #x2,?2<> @ :`  `82`6"?`? #x<>:`# ` ( * #x"  "  ` @`2 ?` `> "`  "`@<>:  (*@(  $8Lp$pp(hT@@@@@è8hĬ00,lլ,lL,D\tLL׌LLLLLLLLLLLHLLլLפ֬lLLLLL4LLL@xL ԴԴԴԴӨԴԴԴӸlL,LLLLLLLLLLLLLLL LLLL0LLLLLψ@LLϔLLLL|LLLLLLLLLLLL׼LLLLLLx@ٴ ڤT@` 0DXh㿘@ &?<#ȱ. `<@:8a 2  ` @ ) @U @@@U&$@@U@V@U`* ` @U2 ??`&4?? 㿘@ &?<#ȱ. `3@1/a 2  ` @   @UZ @@UU &* "@@UP@@VM4 ?? &4@??`㿐<#ȥ.  L &@4 @Uq@T  ?<#cȱ. @ @ &#?<#c@ @@ ( @  $@ `: @@  ` 2@@  $@ @ :` @ @` L      㿘<#ȓ.  @  @B@e㿘<#ȓ+   @ ` `? " ` 2 , *    @  ! @`  2 . @ `w   2 " ȑ+ `$".  㿘!<. #3 3  ` `@ 3 3 3   `   *` 22  ` *  2`&㿘6 : <.   ` <. c    H  € #`D >#"6#(3 -#$!%!8 .2`  * 3 #Ȁ"  '2`  * 3 #@ 㿘<  < <2#ȓ.    <  <   @ <6$`. #   `H €#$` "<  26a >` @Sΐ#< 4` @R< `* - 3 `  2`2㿐<#ȓ.  .`* ," *`" @  @2@ @ :@. @.`2& 2 ` ;"` ', " 0"#\`   `&2 *`` `, & 02*`㿐<#ș. @ ``," ` .` 2 `". @.`&2` 2` ;"` (, 0" "#\`   `&2 *``` `"  & 02*`㿘<#ȓ.  @* 00<??+?c0 "@  @ 0 @ "@ @3` ' g@"g#ȗ.   2@   ` 0  ,㿘< ! !<?@##. ?#<c `2a 2 ? ` 0# ,?$#c@ € 㿘<#䀦 (<#Ԁ`$<!$.  `<#@ ` < ! @}@    `€ 0㿘<,`#@@ 2 ,`` 8",`€ ,`  ""`` "` 0@R   ,*` $ 㿘<  `j @j `< g 0_2$!<#c#䀣-<. # a    ",` @ "  <`@ " 4<#ȱ,` $@@  <!$ `\2=`< D@ @" D$> <ȇ(@ 㿘<<#ȡ. cȤ @<?b" @`"@@" @<2@@#"@"@"@2 $@2"@ ="@ €@`"  . `"#(2`".  `"2`( * "   @Q= $ 㿘 ><:?. # 3!(  <,?!$a %@ $!@2@M  2 I!(%@$?"` `@" @O  㾈<#'P` <#ȓ,  /`<#ȓ, @PP1<#Ȓ,@L  ,`@`@$  2$ . " .Ȱ?P נ P ',`' <#`"`` `" "` " &@ @ "@P}`@Q5 &2    <Ȓ% 2` &2<#` @`}<>"`@"""`4"80@],@k & @R<#` 7`* 7!2  !*2   !   6666<c@!@2 P L 㿘^ <#ȡ. @ @@ @  "$@@ !($@㿘` <<.   "`, . #@ `@  ?"`,"`,c@2  "84  c "`0c"0c"`0c@ @O 0  ,*` $ @` ;"`㿘<#ȓ.  2  4 < <ȇ( 2`<<#`D "#"`D< <ȇ( 2`<<#`D "#"`D㿘<#ș. @ `0`82``4z  #Ȑ?: #"`0@   @ " #ȓ.   ;"㿘<#ȗ.  04@`8  #"0 `` " "`#ȓ.   ;"㿘`0<``<0vK<0sȗ.   a ` ` " S2    , `   0@#   0   ` " =#ȓ. #   " @2  -  `    @ 0 ` `,   @ 0#ȕ. c     @N!@   `  @ #,2 ??`&2??# {"㿘`<``0W-<0T.   a `,` `6"   `   0.   a `,@ `*""` `   0 @cȐș.   a `, `* ` " `   0 @c.`2`&2 c {"㿘`" <. #    ,"@ 8 + 2 ? &? 2@??`a 2 `  `  ,@ 0` ;"`<ȑ*   ( # *@" (# ( "(㿘<ȕ.   `@ߢ  ,`D@ `1 <#l*` €ːġ. . c  `. c n . c  . c . c   ". c@`` ` `@Gc@"`@ * # @`* "`@G . c "` ` #` `* x"`@GԐ . c "`    #  `e"`. c  * @ "Z . c  . c . c  * G". c    `  * ` 7"`. c@    `  *@ `* '"`. c    `  *. c@ D@ •<    `؀ <   * ` + Ȕ `@&㿘N<<aT  aP&aT(aL&aP(&aLNa0a4 @W`DH`#&a0"#`D"`Dp<#ȱ. <`02  4,@CҖ㿐` !!**+ <`Е::; @C<<* 2  㿘<#ș.    @@ `@ <* *`*`*`*`*`*`*`*   j,`D "I "% `.   0. ~ "E  7 D#G. s  2` a  `e *b"2 ]*" `  Q. *"  G. *B"` 2` 1  `5 3"@*." *"D "   . !  `. *"*"  2`  *  `@* ` *`.  ``@@(g 㿘<. # D` < 4*` €#ȗ.  "H`<   *  2  ~0%#ȗ.  "vH`r<   *! 2  i0#ȕ.  `*` $! 2 *0U. # H`<8 <*` * " * " * <"c@ #ȓ.  `@"`H:"`8"`#ȓ.   @   H'8 @J )& '& #ȱ.  H  ? < H<D ""D. # H`<8 <*` * " * " * <"c㿘!<* # 0 8` ;"`㿘!<* # 0K 8` ;"`㿘<#ȓ.  ," @`" 㿘<#ȓ.  0" @`" 㿘<#ȓ.  ," @`" 㿘<#ȓ.  0" @`" 㿘7<ȱ. 5`,9 ;`0&`0((#`0((&`0(( @& 0(( ' `0( (@&`(`.`(㿘!<. #  2 * * @# `2` *@ * #` 2` *@ *  `2` *@ * #`2`*@ * " `*` * `*`` 6 ` `@D. @"`ǐ@` ;"`㿘#<.c@" 4@  # 8@"<@ @Dw"@ "`@ * @*`@* "@`+ ;"`@-@% >"@<! ?"@ *`@ )<* "@` *"`@*@"@*@"@@"@@"@*@" 2 ``*`  ,-+  `? `@* D `ǒ@  ,% D# @(2"L@@@!# @!""""@""`@ " Ւ ` 㿘 x<2< ߀!.`8<0\< !<l"#<<# `<! €0#ȗ.` `, `?"` `,?"`, =#ȗ.` , *`" "  ``,?"`,`,2`* @ ( "  , *` }" Ր<!.`@ `s<#ț.` ,* "@" ", ;e"#ȣ.`  "@Ce "` R"#ȣ.` *"@CR "* ?"#ȓ.` :"<#ȓ.`  4"<#ȓ.`  ."<.`#  <?` "<"x*` €#݀@"`<<!t. €# "<#  "<# "<#@ , *`" # @", {Q"0r0K0# ,2`ਕ* `+  " # "<# "<# "<T 0<a@ ` *`<@ 2`  *  `@*P!R#" @`@  @  `@`D* "@@ @ "@@ `@ (@ # "`@" <#@ =#ȐЀ    #Ȑ#9`@`D*  "`@ߐ?" " #@ vDH*` * *   `O` @ * P*`* W @@ +@ X*`* _ @ @O+I#" @`@  @  `@`D* "@@ @ "@@ `@ (@ # " @["`< *"`<?`?* w@" h; А#`@  "`@Ѐ #@D* *` * " `@`D*@ ?А"@ # "<# L"`<<!D* € 0  0#h"9D  HL* *` ""# h$#@ D "(FJ* @2"2"# h D  <ː 0#`( 7"``5< l*` €#`D ?"`D0jD0#`D 2 "`D0D,Z# 0y#`D 2 "`D0D,J 0i#`D 2 "`D,D0: 0Y#`D 2 "`D,D0*# 0I#`D 2 "`DD 0 09#`D 2 "`DD 0 " 0)#`D ?"`DDA,0#`D ?"`D`H ?"`HD.H0 #D0#D0#D0#Dΐ0#D0#`D< 0# D` ` , 2`* ` * *# " " " " " 0Đ#`D<!@  @bԔ#`D 2`H "`D`H 2`"`H`D`H `"`4H "8 000#D 0#D#0^0#@@ " <G8 #0t#0q@` ?m"`` h"#8c" <!?`&#  E2`& & @` 2&20L0B# U#*`K# 2#Ȑ# *#` &)" `0B# U#*`K# 2#Ȑ# *#` 6 `@@"`" <#"`<㿀'D) 'H '? < 耢  <"   H "<D;  ? < -#   7 $ 7!7<#䀥 <<`H<\8 ?"`H @O Da$ BA`<\8 @OH H ' HH "  H<\ ?`8' H' @Oc S $O*    ?*  " `?*` ` 2D`C  @ *`@ "  @ *`@ "  @ *`@ "  @ *`@ " 2 @@ *`@ "*  2   * , @`!  @ cȑ2  =!@?#: cȀ  @`2   2 c< |`x@B ?@Ac"怬@wD@   `  `% 0:@?c$ ,*"@ "", {%"`2   *2  ` `a* *  `   `* 2@a cȀ`6  ,c,?@ `2  d ; "` ",` "`` %@ `: 0@?DDa$ <\` %c@ :` 0@<\8` @N H ' H㿘<c#< %<'<H/`c"c   c  €"` 2 c쀢`!<#䀢@ ?H ?J#@;5c?$cЀ @$ <@U#<, !$ `2 $<c@ 4$㿘<<#̦ c䀢ޮ <   @NLն!<# " <? "<#?<-# .  <<!!$ `䀥2| @  `  -@ d"Q@-2  #@a 2 @ ` 0@ ,@ ,@" ,@`$ `,?"`,  #`, "`?"``,?"`, ;" .0 "@ΐ@ ,* "@"@", ;"@`.` "@ ,`* @2@3 `?`$"``` "`2@-2  #@a 2 @ ` 0@ ,@ ,@" ,@`,`"`,@`$"`s@ @MR " "$<(0㿘V  2w?؀< `   ` !!`"d?D;@  @` ?`2U??* : ` N<"*` €@C D@@@c 0<@"9<) .@03.@0.@+ < `   ` !!`2D?`  ``?` ?* : <"c <#?㿘@W㿐/  !$ @? 㿘) !; 㿘 !V "  <!.  <2`  `D*  `@ + #`D㿘 !V " a  <!.  < D ` *# D㿘)}@㿘V !"@ "<!$,  "@ !` &)<# ` 6! `6! !"")㿘'<. " ."`"  @A $ r@8"< < < (`h  `  ? @ * `*@  * ` *` *  <+ !!$"`A<*  $0   8@ &@ 2@`㿘 o? <"#Ȁ@?<<?"cȬ .``1$`".`a <`ȟ@` `€4  쯐 `2 "!@2`  `@ˤ<w! `<!`o`<-`# < " <!<!  V0<!Q<?  > " D`; `((8< ؁㿘<#<<#ؒcȕ*@  `(€ 0  `(€ 㿘<8< ?a<\"8"<㿘<<#Ԥc䀢l <<#ȱ, @ <`"@@ @ (€?`=$0P, !$ `  G$ِ<#<!@<b8<\<c!8" #!8 #b8<8< ?a<\"8"<<# <`"@  (€ 䀢 `$<  `<@   <#؀` (€`㿘!<#Ԁ 6#<c䀢 <c<!`0*#<\<"a8  "`<<8!@@ #a8"8<  $#Ԁ`c@ @A<cȕ, @  (€ c c㿘N <<8< ?$("8 <Ԁ <@<\<!8 `"!8 "8<܀<@` <\ 8"8㿘<!$.  ` <c@ < 0`㿘<  (< < `h  ;`  `)D @   @  `#D @    ` `#D @    ` `#D @D   @*@ @  *@ @  *@ `  `/<  (< < `h     <#Ȗ , `   *  @`*@  * ` m > 㿘u 㿘o 㿘< < < (h`<#ț. `  @  * @  `*@ @    *  6㿀<!$-`? `'@  @? @ N ```"֞` 20`` π ?  :;@@D  `?`      ` ?&` ?`  ` `2 @>*`@?   <c@ ,€ ` T  ? `D;   @Ge j?&`#<`H!<\ 8 ? $`H @H֞<cȕ-`@  ,€ @Hڞ`H $`H E&`C `` *`@>)2 `` `8?` 耢@` @` ? ` @8?䀢`  ?䀦    D;   @F   ? '㿘<#ȓ.   H   . #@$  !㿘 .`<#ȓ*` <#ȓ*`  H €<ȑ* /*@3*`㿘N`N@D<ȑ* @2 @<?㼀 @㿘<6#ȓ.   ?<?"c꼐㿘< <cȕ* @ * @7ד2` 㿘#< a陒?!< ! ? <?#Ė ! a" ?$! 㿘D < ;a, ? @FP   " 㿘<#$cC D; D  ? ɐ      @ @   @  @   @  @   *` *`2      <,`#@  + *2 ?   *`?*+`2`2   *`(2 2` , 2 *`2` * 4 @<@-   @<,` G 0N   B < !䀢 ,%!?0)^l?0$/< k7<?  `?/<  7<? @<    2 < , ` 2ܐ  < <`?!,c  `@< . Ő % 22  `@ 22!/< ` @ ?  ?? ] ????㿘 Ӧ <a8<b )h )l)p')<8< < !da X2  "  " *$%2  2 ?@ $  2 XHH/  ؀`" @ `"!@!  `@  ! !| ! D < !" $" (" ,"  0" 4" 8" <" @" <"   @"7  Ԁ`"@ @8P @!*` Ѐ`' @ " <!H  `$! l 2! p      ! 4$ h!؀"$! 4 2! ?&!&!&! `.!% h  h€?2 h0 `@㿘)t<)x @AH` &)t" 㿘  < `?㿘؀  h 2 1h- 0*!T  `ސ`   2!h  !h?$!$! <8 4  ll@""4 2l㿘<#  @㿘!$  !(&!$$@" !%l ``.!% !!( !~)p `@㿘!$(  , !(*&!$$@ l!% ``.!%^ !!( !Z)p `"!@!  )h `@)hG !)pD !㿘 " :?< ap X*< !`   @ < !\*2 Mt  2?"? "? ? <\"@$0㿘? *% $` `< !X` X<*!< !`   @ < !\*2 $  r?ol k g䀢`20a   `L  @@ 8 @@  8  @@ 6?>2  Ā Y8Ā  `@@ >`<\ b@"4 @?͞  @?מ 㿘< a܄ @?ɞ 㿘< a܄ @? 㿐. 'H2   )?T` "@ې`P/ 2     '􀤠 @:@ߐ 4@6`T@@ $ʒ  ۀ`&@` &``$&``(&` `,&``0&``4&``8&``<&` `X@  @ $  @7 $T` 2g`P  @:`@`L`   *`@ 5a@5`L`L`T 2`L $  `L% %$%(% ,%0%4%8%<% `L X`2 `L $d  t'@7> $`L P"@ "% 2$%a%a`LD "T``2$(a %a$(%a(`P"`"& "&$$`D "А `$@ O<`.H`Ѐ`"+"@ "%HԀ`"?<@;< 2?T` 2T`   "(?a "a %@52 H""A $` `7 $`2 $ ?g!@0݁㿘!( .` T"@  D "  H X $ "   H$"x  T.`"@ D "  H X $"  H&"c X`<``X!*< !`   @ < !\*2   Đ @ ? T `T"@T `?`(T@& T!<!Ő 0v-`@ +`!<1"X @ +`!<("0\ @ +`!<"hP"*hP @ +`!<"Ta @ +`!< "Xa @  +`!<# 2 08a(<#h01h€5<   ` a$ - ll h@ `0 # pp  @ ` " #h` d@@  #,ilil ih@ ` #ih` id@@  #ipip  @ `  # ɐ1 "a? $a!<#$a? $!<# $&`X @=:a @=3<8    4 <  !؀@`@2 4"! 4 2!X`"Xb`^Ԁ`<@<" @3p @` *``Ԁ``@`@3b @<`쀢 #<H/``"`쁊   `  €"` 2 ` H/``$`     €"` 2 P`&`$ *e ؀ ?a&`$*`2 $*`<c  $*`2 %*`<# "(2Ȱ?@ `$ &`$ *`2 %8 )< ",T`T`6`* * 2  T` T`@ &`?@a@I E>>< !dL&` p "R`؀ 2R`a 2 R`!!hl"a d"R` # R` a '< 耢  `!<’# ( R# `$ 㿘K 㿘 <`  X`*< !`  @ @ < !\*2 5\  2  ` 㿘 2$ 6"  0?""" "HHo`"$  HHo`&"   㿘`<` `X`*< !`  @ @ < !\*2   2P a, F'ilil` ih@@ 2`<ip   @ `2`< 4i`< ) a"`&`<6`@6`Ba,  ilil` ih@@  ip   @ ` 4i 㿐/؀< `   ` !!`2D?D;@  @/?/ 2 ?   㿘D;@ !@8    ? 㿐D; @8ϔ    &?!@6F  2!  6 a!@`  ,  4!4!4! 4!"6a"6a6a6a  *< <   !<  ? X X? X D; @ @?򀠠 ? $ $(" $ p l  7 4?؀0 %`*<   !<84"l؀ " 42l ?l!!h" d " 2D؀  ?D; ?a"㿘? &؀  @?a l@"D?;    ?sl 2?&a  2a ؀ ?a `4D ?; ?"㿘D;@ @7+ + ? 㿘D;@ @  ? 㿘 ! €? 2 U €  ? 㿘`X< *` < !`  @ @ < !\*2    2U?T` T` "a(` / "` %"`#`{`{`z `{` 0+ & =" `{`z %   {   2 z @Ғ  ?{"`0 ya % "À8 & ` `$U_a`q_z"`` h"7 "qDW``U`^`   "e   ] r "~ }`A  g t`|w s @8*m  @87g ؀c?p "9! 5! WJQVKF; A?`&0<9ꎒ50? € 0'&   .*    =`耣  =?㿘 N ؀`! @ `<8@<8  4 :!؀`$ %t l2%t [ & 4`" ` 6 4< !d` `*`@   2`Xߐ `ꀢ` 42!؁㿘!!!0<!4 @7^DHo`&!0"쁊`02!X #\'\&!XHH/ !\%\&!L&!P &!X!\%\HHo`#\'\&!L&!P!T&!T   㿘! `   ?#< "P * # < )d !!$2)d< !$@&!$)d< !* 㿘!$@!0{0<!4 @6۞Ho`&!0"쁊`㿘+@.א&<b  @@-- ?<c&!&!8< !\%\#&!L&!P&!<&+&)|&!@&!D&!H&)&+؁㿐 l / 㿘 @ <  V d 8  &V  "6  l < <",& laT& & " "aT˸㿘 D ` R?< !T2RV @" ;? < V  K  "  1V   d ` "`$!T `"V  "`V  @ T,`@ " X"@ $ X@ "V "@ $V `@& T} 㿘 2<  !` @<   !\ .` 2 ͔ċ@ÅƋ@@@{@h@R\^h^h`H㿘! ! @5͞ `@㿘H/`&)&)&) )*&)"&+&+@-)Ґ㿘!($@ l!%`.!% !!( !)p H`i2k iȀikЀ( 㿘`x@ "n?a d "/i "BiE` ?` 2&ia ``"`p€ &iiB&k"`i "A `  6 &i3&k   " @  ,?&i <`l "  ?&i  <4h ?h 2`pi &i`p € H x@ w 8P8 P D;@ @3$  _?@O<4"hJ "J t ")),! "!&!! ` 2&)! `23 t)+&+``) '` *` "`&)&+Ԁ ?&) `" @ 2* `2`) &)`@  t`" l@ l 㿘a b<4"h ` `p€ ^ @`p€ `i &i 㿘ikЀ@* a `2 `S 2` N   (0H`ikiȐ" /"@&i&iȁ0(02 H`ikiȒ"@ o" &i&ii@ `p€ /ii * &i&ia a ` Ւ 0<4"h ikЖ @i /` @  2 `_ H`i&i?&iȁa` $!i2 `p€ \ii @&i&i  `2   `8pi 9ikЖk<4i"h 2 @    "  a b2  / 2 i @8&ii(Ei`p€ i ?&ii8`p6i  "!`pa b`p€ `p `p€ i ?&i  "`pa b"i`p€ `p `p€ i ?&ii`FkЀ i@ `p€ /ii`*&i&iȆ/@ ̀ ) ? )@>Ho`)!)Ȥ$ $44) @)S)&)Ȓ@ o@$$ &) &)Ȥ 4) @)=))Ȓ@ o&)&)ȁ`)" t- - : .<! €)@ H`)Ȁ/ ))* ))Ȓ` o &)&)ȁ!$(   !@ ,,2@}@ 2 "  ` @ <4"h ` @$f` ` 2 `Z^[1W ; * )@ 2  k`   p€ /)) * &)&)) *@!&) `"!)Ȁ/ p€ (+)@)&+Ԑ!``H`)Ȁ/ ))* ))Ȓ` o &)&)ȁH`)Ȁ/ ))* ))Ȓ` o &)&)ȁߢ ` @ ٶ`!2   $@ @2 @$ `@2 `¢@2` `  `   `  ` ! $!s ! ``0 `  `@  `@2 ` `  @" ` <@2, ``  @& &)`  v`@  p€ /)) * &)&)! bd p€ ^ p Z `@/` `    @@(`  + p€ /)) * &)&)ђِ ) 4`)  ) / 2))2 `` H"d))Ȁ/ p€  V)@2 `+)@! @@1G @" ` `@`  @~` "!)Ȁ/ p€ +)@)&+Ԑx!``2)H`)Ȁ/ ))* ))Ȓ` o &)&)ȁ))̃0(` @*@0H`)Ȁ/ ))* ))Ȓ` o &)&)ȁ+!, )&+&+̐ / )l )l)p `)l !)p !~  p€ /)) * &)&)! `")Ȁ/ p€ b 2+А  !)@ )&+Ԑ !` H`)Ȁ/ ))* ))Ȓ` o &)&)ȁH`)Ȁ/ ))* ))Ȓ` o &)&)ȁ!  `  !  ϔ i `@8 H`)Ȁ/ ))* ))Ȓ` o &)&)ȁH`)Ȁ/ ))* ))Ȓ` o &)&)ȁH`)Ȁ/ ))* ))Ȓ` o &)&)ȁ)l !)p !!` @ 9 H`)Ȁ/ ))* ))Ȓ` o &)&)ȁH`)Ȁ/ ))* ))Ȓ` o &)&)ȁ0 H`)Ȁ/))* H`)Ȁ/ ))* ))Ȓ` o &)&)ȁ)l !)p !$)'<) @`d@ &)`!<x"(l)Ӑ@&) &)!<"H_Ɛ`> t`")@)@))Ȁ !, ")l-t )l )l)p )lM !)pJ ! ! @.ʞ `@?2( 0   * (   㿘 ! )2  !* * 2``&) c  d  `H/ ) @&!@!@.m @$@.f` V  `0(`*@.Y `0(`*@.P `0(`*@.G$@.B `0(`*@.9 "*! `0(`*@., ` 0(`*@.# `0(`*@." ! `0(`*@.!@$  `0(`*@. `0(`*@-`   `0(`*@- `0(`*@- `0(`*@-؞ @-H*/ )* &) 2  2 )  " ) D @)*@&)㿘) 힒 &)㿘 2)*?ꀢ 2)<X`<X     @( $)?)@( А $) 4))*@$)㿀'P'''') 2`<-"`g? `*$$%"#)؀2)!`4d<") ")  K?vd F?d  @>)  2 ! " !*@ #*`` %6))l `)l)h@@ 2 ))p  @ `"6))$ `$ 6)`   6)`$@+؄ @,'? @,۞ '>''>''Ho`)l ")h'&)l`!!@,ÞPa)l;*%D @'*P?b'P !"@)% @6 )`"%6))@")+̀  `   `#! ? 86`$@? !@,!@,pP!!$@쀢2)'D; @ .P?'P)@PP )Ȁ ߞ);)Đ 2`(` `*@,T)@ J H`))Ȑ  /&)&)ȁ  'D  P*P?'P  P+̐? &+&+̀ )Ȁ 2)0P H`))ȶ"   P8. ;D    ))Ĕ@*2 &H`))Ȑ /"@&)&)ȁ$@"@$@ H`))ȶ"@ 4 P8. ;D    ))Ĕ@) & H`))Ȑ /"@&)&)ȁ@"@%%@ ? "`2P !$@!( !%`쀢" %!@+^ @+"XH`  ` 2"`)l` )h@@  )p  @ `"6)!쒢 P ' @@+  @@+2)㿐!'' a ` `*$ % D oHo`)h ")d'&)h`E `". l!2  2) l#;D   ` `Y & t  Ô ö t`@   &`$@2? !`2> 2 ?!( "!! 2!?!H` `2"`$㿘)p `"!+! `"  `!)@+̀    )Ȁ     2 A!$@"!!( !%`2 C! 2 譐 2  Q2 |! !`"  "  6)6) |@ $ O@㿐 |' K'Ho`)h ")d'&)h`` #!  |@ " Ґ 2 €!H` `2"`㿘2<W#p00@ @* &`  * @& `  @* &   ` *@ @&  " `.  `  " @ * $ p!''' ''''' 'Ho`@! "`"`"` " `"`"`"`"` " !!!`   "@!2)))Đ*@&+&)&+̑H*/ `"!(! `2 !()Ȁ )lv !)ps !!( "6 !$@"1 Ѐ$  ?cD  `?!@$  `D?c  `? !% .!%  .!%!( !@)l!( !<)p € 쀢€p ܰT!@ $D;@ @@В Г*`?2`  'D`  `ԓ*`?2`  'D`  `ؓ*`?2`  'D`  `ܑ*?2  @ @'D` @u@& rD;@  @'В 'D`  `''D`  `''D`  ` ''D`  `//D` @@&t ܀ `D  `//D`  `//D  `//D`  `//򀎠  ؀`@   ?}а 㿘D;@D a 6@a` ` 6`` ` 6`` ` 6`` `  .``  a`@% a `D`   !.` `  ".` +̀"! )2+ )Ą" )̘:`(@ `0`K "` :` !    ! 2   2㿐!// / /7D;@ @%    ? % "" `"  " "`" 8" ``  "  ""   * !* "h` "!0;''' ''''' 'D@  @%;    2?/W/x 㿐!; / / / / / /D@ @%    ? 㿐D;@ @$    ?! *!*`!*!*`!*!*`㿐!; / / / / / /D@ @$ʔ    ? 㿐D;@ @$    ?! *!*`!*!*`!*!*` 㿐!$ 2 / .`€:`0 " l3 l   㿘T` T` "a(  "D6 d "D   `Vb`W=0 "D=0 "V  s+D=0}tR =0t `uM`  ` 2 `eN`p=0_`/=0Z ` ``=0L  "8  =0@~=0<^83Β/* %&!;D  !&! &  &  &  :D .D  !`@# ! `D  !. װ  "D  . ǰ .°    L    Zh "a$ ?0a$   $a$א @*@$a$ a a `y*`:`u 9 p"` ?0h ``؀`"`@``] @Y D; S?`|` @&0Ia `i,D; ?&8D;D  !&! &  &  &  :D .D  !`@"” ! `D  !.   "D  . ݰ .ذ < `   ` !!`2Dư?;  ! !"D @ @ !!" D @ @ !! " D @ @  !!" D @ @ !!* D! @  @"B ! `D  !!* D @ @ !!b* D  !!* !D @ @ !!J* "T` G?T` "D0A;  ? 4` a$ .  a($a$)*a%a$*@#$a$; ?a`2 &0D;   ?  a  7& (&  4$㿘  "8@' D; @!  2 ?@ > B?@㿘<@b@= "8o "8 D;@ @- !?@@&D;@  @Q@!Z 2 ? > B>㿘<@:b " 8@0㿘`,o!< ?@"@ $@@"@ $@"`` 6```?`k" " 㿘<"@0 "8o"8 " &D;@ :&@&@@$" @D;@ @ ڔ@@&N @B>㿘<"`@   " 8  D; @  ?򀠠 ?򀠠?8  *      :" D; @  ?򀠠 ?򀠠?8   +     :"   㿘  D;@D  ?#@ / @ @`$ x@&  p @!  7 T P - ;"8@7Ԕ`@@3   , ( "  @!j! pD 1@  @ "pp$   0 @!G% `@ o`" D@:@k%@%@?㿘`  ?`?``k"@ " ?  :     ? ?;  @B; \ !  ?㿘 +?* 2 `'<##*` €< " &` < "&` < # &` < #H&` < #&` < # &` <! <&` <! x&` ?` "   € t@a8@YS@㿈;@E 0< h@ @: 㿘!<@"@" 㿘 <A!$.      $@ 㿘 <A!`.   ׬  $@ 㿘 '  h ` '   L.  '@`2*. 4`.` ( @  g@.  +@(@*` 32@*  @. `( 5<d) .` 0`&(0&㿘< ?a@ &` ``L ``h&  +  `4@ * @ * `@ 6. * @` `g*` @ + * @ @,``3@ 1 ) `@* @ * @<@!d@(`*@@ 6@@ @ `#@* 2`@ #@ /G` C@`!`" &@" &`&` & `& 4 4 : 22 22 22 %U"2 c3 3 2 2  @@& &    <B!\ !<B!` !㿘<! 8 <@<A*8"R`㿘<@<A"aI㿘  <A!$.  `<@":!㿘 <A!`. @  <@ @ <@@"#"㿘 @ @ ?```4 `H  3 +  #`T`za##2   ` !   ' ; @      2*@@@ 0(@  @  Oز`      @& && & & @<A a  8&  2` - "@& &    <B!d, !<B!`( !bH#;j&. 0#`v'''''  pk @ ` @$@$@`4 7  D;@ @ɔ2 &?@ה&@N    2?~;j@`!T㿘<@"r 㿐'' b <Ba\H`a\ "'"a\ 2$>~b  !C  & <@!b2` 8 $@"?!H` `2"` "1` "㿘<@" 㿘<B!``"<@<@"쀢   A ( X ));@ @` D @@@2 ,&@#<@b #?݀@2`0?<\`@"4`` 2$,$㿘""D bb ?0 ""\"N?0 "?0<@; ?& @ !! `?D;   ? ?<@b   #  4# @ # # b `V<B!\~ !<B!`~ !İ \@ !! `<@D;b쀢 D ?& ?    ? T  @   #@? ?4 *  <@ @!b  y?w \@ !! `j?D;D   ? 2Z? V     ? H? ږ  @ <@b " b ""b `. <B!\} !<B!`} !$ \@ !! `<@""\@ !! `? 0?㿘 7  @@  @0`(` `@@ 1 ) @`  @3`+` ` @@4 , @`  @0`(` `@@1 ) @` @3`+` ` @@4 ,   @ 0`(`@ @@1 )  @@3`+` @ @@4 ,   @ @0`(`@ @ @1 )  @ @3`+` @ @4 ,  5z@0`(`@ 1 ) @ 3`+` @4 ,  @ 0`(`@ 1 ) @ +` 3`@ 4  , 㿐6C<!`"" !,!<!<@""  $@G!,<!* "` .2 .<@@"" "  ?*"@ *`" *  * *  㽈) "==؀ < `   ` !!`< <,a!@ ܢ _@/54 1 /0=023Ұ=0:"䀤7א#6;=?0IH:jDE"8DAOD=0ՐM L9JJKj=0ǐN`=0q"0h"Bd"z  b c=0esFDl k:Dij=0mȐpp=0b"b"D rĐb=0xb"D tb=0nb "r bb)=0ab 7< b D=0WP@ ܶ<!  €H @?#6 @Ԑ   `@ː ܒ<!   €0.<! L + `? /0 2?0`?# , <!$  <*#䀤  #0Ϋ  <!$#; `WD퀦"   " ?  ?  ,   ? @,  ? @ ,  ؀`"հ @Ѱ   @ D #;"( ' D #;" D #; ?0  g,  2`  *  `@^,   D #;2  א &0< `   ` !!`" D;   @    ?cLcM @ü D  ?&?@ã;  @    H?O cFcG( 0:<+"*` +`<   <!2`@ & D"`""D ?60`"<<+*`"`  " <"~@ p!<,b?r"b<!+ 2`@ 6 <֐!P*` ?0 ? ` Z<+*`" -<,b  \@@ !! `İ?!ߒ  ?b* "0"~2 "*```2" $"<* @   "2\@ !! `<* 2 ` 3  2  @¯ 0{;  @" " m?cH耦/cI0 0a<,#@( D !K    @  *@ K    . : K 26?04-<,8<,<, <,c@ c<(4"     @, `   , `"  c@, @@q逦 @l$@`< 8  $@/<,#@*@ "@ ` <c@"<"X%<!" 6.&.   #4c@"#4 @ & <,#4#@ @ " @"@ `#4&@$ @ 4#4<,#4#@*@ " @"@ `#4<,"8 <%#48"" %<%8c@@@c D;D  <."@& ? 2s?<."@*`   <-c@@ Ԁ ѐ ^?D;    ? O?<-<.c@* "@ D @ @   2  *` -0? <*` 6 D   , # D@`D; ?.0 @I  ? <`<"a"?D; @6    ?耢 t<$? 222 2 2` `""`;  <!$ @ `   ư İ?; D  ?  <#`6<!  .  "*`! 2 *`  >*  .  @ ?60< P @#;D > . P@  >! 2  > ޖ t >v?t q< D<`"#" Dc >e?@eaY<!$J`X?`?""M J!<X  $ @ ?$ >?< ?9?!<< İ #<!< P. @ "c! 2  c䀦"  !" l  >$P !.@ "<!  ?<#䀦 < ! ? L D; D  ?     * **`іD; D  ? ʐ                     ,`  <"&+ 2 `,2   ,`@ 2 * 2 .w?@ 2 .2 . 2 `,2   @  * 2 ?0^@  5 ` X?,`2 <""$`<"!,,2 2`  >E=< ` !''''''<c    !''''''˂%#?IK;  @R    ?ckcl?ꀤ2'?  $?$? <' ''   $?$?$? <' ''< ް7 7D@    k i?򀤠’ !<'#' #@ 0D;  @    ?򀤠 ? D@֔    ? ?@]@t?@{@wu?D; @    e?<c @u0^;  @    ?  D   ? cfcgڐ <Ր?c @0<c@u) `   ` !!`<! *`< `   ` !!`<!?* =㿐<!`Ĥ''H``Ā "'"`ā<# !   ? t ! ?H` `2"`!㿘<* $ <*` ? `?*+` * 2` 2  2`  " "`㿘<#!<*!$ <"# ’ . J `2 . R  nH  . Ɛ. $@ `  ȍ<! <! t #㿘<#䀦 ,<!J `' "#<a$* @ J `2#R  n  #* @"`##$*  `㿘 * ?<#Ӑ <?#ȓ,  @R *`*  㿘 `޲ ?2? : @ F  : 2< @ (< ??㿐 <  `+<\`H ` ?8 "`H`  @  <#  w  8` @߰?H &H $" 8` @˰?H &H8<#ȓ, /@%`-;D ` `,`@   ~@ 4? / /񀦠"?;D @ ` *@  2D?4 : @r(ɰ D ; `ѐ`,`@  4  :`ɕ 4 : % %;D@ɲ`6@``@ w 8DD ; `ɔ2 ,@&@ > B 8?@` @H &H㿈 < <\'P +8`H  ? "`H`   @  <#  l `8` @? H ' H`@$"`8` @x? H ' H8<#ȓ, 8'@%@@Ȩ?#-;D @` @     є @2D `4$ސ;D  `   *``2D2ː4`@: @Y7ȗ`*D ; `  Ȳ?,  :`@*`2`ȹ  `4`@ :`m 4`@: %@@ "!;D@ @*`*`2`ȕ ` J @8D D@; `  a , l %:`8P&@ > B;` @| H ' H㿘 *  F? ? 㿘<!!. `"@.`@  "Ǡ  &@@y" .`@@a8` (, ``.`<B<!h*`*   (! ` <Bh* `(@2 㿘<#Ȥ  ,` `    `>㿘D <";c  ?  < .     3 Ͱ 㿘D <";c  ? <##<c. *` @ ? ,  c 㿘D <";c  ?    2    D; <"  ?   @ 2@   ` 㿘<Bbd""bd  `"$ , @  y , t$   "h$ 㿘<#ȱ. a  " ? & ĐN㿘<#Ȯ % N-a H"G `@2B !   @ # `@@ @`  ` @@ "` Ԥ  `% !o" 0> 㿘6` |`, 4  & `|"?,2  |@  ?    $@??@ ?* 4 .4@  &  㿘<. #a@    (?   &    2  "?  & ?@Ð $ a "<Bbd""bd& &  㿘<#ȓ.  !  u?.` 2o 0 g ! ,``"` ,@ ?# .`,2`b 29``?,``ߑ,`<Bbd""bd* ?2`@  *`*2`29 2*`2  В  0`%!"0  ``㿘<B"d<cȑ. @a 2F  "a"@? $W5 " /<#a<#a ` , ܕ4  2 $ r  a@ %dR  %d㿘<cȕ* . @ @ "?a2!?@ "  1a @ "!"@㿘<ȱ. . .` (`#(   @ `(@ 2 ! @66``? $@ م(4+`0 ?<ȑ* 2 ?@݀)?@?@ ~?<2! a! :` ?(  :`|  `?(?㿘<B"bh㿘<a@ @ <Bbh㿐 H <B"l` '<,``2(``@p<& ` @' 2 (`?& , & \& \ \ "!@ 2``Ց,`   - @ې` & \`&  J   <B<` l,`@ 2` c`@&@@`k㿘  " o? h@` 8?" T 㿘,<J#h#hJ   JK   JK "@ 2<:  @̐ * <B"l ` " <}!#p<:<<"b<:<<<P Ța  & & & %ܢ  d?& & & & 6 X6 Z& T. o&  `@7 `6 P??㿘<;3<; `#"X  6 P& & 6 X& T. o& . `& & & & 6 Z@2" `2" `?2"  ` 2"  ` 2* = ` `2* < 㿘<B"l <  2 @c`@]$  ?<Bl  "ll( 2" 㿘u?  J  Ȑk  Րu?0u 㿘ukaǐu㿘 `\`2 p<|\ P p [    p @ r21 [P-  @ g[E  `"$ @$ $ v64 t , ifO$  \ ` $` \` @@ ` $`$` $@ \P 0P ? (  2` 2@ 2`:2@ 2` 2@2`㿘 \ 3?  & $     i /  h /  kc/  j /  m0/  l! / @2@>..23`f`?     9    0>. . 17@ `? >1?7 7  >7 7 㿘 | $   2 0   ,  `, - $ * 4` 4@@ !@  cd@ d@ @!@<!{b  | < {Z"?4@ B4@ | "  @ "@ 㿘 \``*    `@`L`0 `$`Lk$`0```X $`X``P $`P` `L $`L``T $`TS`0 O$`0  /?Y     `$ $ 2`(<{"(`8 `$`84,`   =$`$`( $  ` \@ @ $ $ \$ <=LYV`* @*`@*`@   u.tڐ4 td`  $` 4 ,`` `*` $` ` ` 㿘 \   k   @J 4`$ 4 ` $ ` p $ p$0 d  `$ d  "@$ <`"X<"x<" z 4` 4@qِ0;0+< h`$ hzt"4` 4@r]Ő0'     * ` D $ D  " $ D $ D $ $ $   *  `$  㿘`\` `<@z8" &` 4  &4 >4$"ߐ""`f``@4"@?@<`$? `$ <`D&`$""`D`4 $`4(`0 $`0?`|`<"@* y 4`|  @ "@Ր=&`$ @4&` P \<&`<&`<= h"t bܔ @   !<@J"yŐN?4 4`|?`  " 4$ $  . & $&  22` -` <@ h , * ``$ ` , * , ?2* 2@!@, < , ` H  $`4'㿘 \  & $. h 4  4  ] 㿐`\`$   @<#<a@`H" c <@yN#( 4 `$ 4`\ 2`2@ | <y@# | `" |?` ?" | ` " .a@ &`H.`&`${&` p  \H`  @4"@?@ < R <& < ,  @ $ ,** `2@*  `* 2@ !@@$@@,! @*  H  $ 5<!@ p&`H @2 WҐ  @4"@?@2&`$ | " |&`$ | '  \ 㿘 \;n   P  p?& & 0-& &  t '  ? N 0> $N00(@*0@ t޴ 㿘 \   9  $ <!@ g9`0/ $ @  @ <!@ g)`& $2 2L P!@  4@0@?*@4@(<`D& $""`D㿐!8   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` " &@'   &@!8 ` !` "&@? &@x!8 ` !` " &@'&@i!8 ` !` " &@'&@Z!8 ` !` " &@' *  &` ` @@  ? `  ? <w" ` ?# @6!F? 6!F !@*   &` ` @@-   ` % ? 0 $?Ȓ* 6!F !@* *`2`  &` ` @@   `  ?  <wB"@ ?㿐!<w7"x!8`2<<w0"<w,"<w)"!8`  !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` " &@'   &@!8 ` !` "&@? &@s!8 ` !` " &@'&@d!8 ` !` " &@'&@U!8 ` !` " &@' *  &` ` @@  : `  ? <v" ` ?# @a 6!Pa<vx"0<vt"0 `@<<vm"0vj#㿐!<vb#(!8`2<<v["<vW"<vT"!8`  !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` " &@'   &@!8 ` !` "&@? &@!8 ` !` " &@'&@!8 ` !` " &@'&@!8 ` !` " &@' *  &` ` @@  e `  ? <u" ` ?# @@6!F<u#P!F<u#`!F!<<u#p0u#㿐! !8   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` " &@'   &@!8 ` !` "&@? &@!8 ` !` " &@'&@!8 ` !` " &@'&@!8 ` !` " &@' *  &` ` @@   `  ? <t" ` ?# @!6!P!   @@   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@H!8 ` !` " &@'   &@6!8 ` !` "&@? &@%!8 ` !` " &@'&@!8 ` !` " &@'&@!8 ` !` " &@' *  &` ` @@   `  ? <t8" ` ?# @ a@ 6!F  ?"  b  " `!4  &!4 b ?&!4 }"  b   "b 0 㿐!8     !4 2!@ $   $ $$$ $ $$ $$$ $$$ $$!C  2@ $ $$2@   2@ $ $$2@$  $s!8   !  " $'   $a!8   !  "$ $P!8   !  " $'$A!8   !  " $'$2!8   !  " $' *  $  @@ `   ``<sc"  ?# @!8  * !4 2!@ $ *  $ $$$ $ $$ $$$ $$$ $$!C  2@ $ $$2@   2@ $ $$2@$  $!8   !  " $'   $!8   !  "$ $!8   !  " $'$!8   !  " $'$!8   !  " $'!*  $  @@ * l  ``<r"  ?# @4!*`2  " 㿐!!  `_&! `"!8! !8   )<!4 2!@ $  )< $ $$$ $ $$ $$$ $$$ $$!C  2@ $ $$2@   2@ $ $$2@$  $!8   !  " $'   $!8   !  "$ $!8   !  " $'$!8   !  " $'$!8   !  " $'"*  $  @@ )<   ``<q"  ?# @!6!F q#6!F!@*   $  @@ ` {  ``<qǐ"@ ̐ !8   !4 2!@ $   $ $$$ $ $$ $$$ $$$ $$!C  2@ $ $$2@   2@ $ $$2@$  $/!8   !  " $'   $!8   !  "$ $ !8   !  " $'$!8   !  " $'$!8   !  " $' *  $  @@ ` Ӑ  ``<q"  ?# @? @ 6!T !@*   $  @@ `   `` <p"@  &!   !4 2!@ $   $ $$$ $ $$ $$$ $$$ $$!C  2@ $ $$2@   2@ $ $$2@$  $d!8   !  " $'   $R!8   !  "$ $A!8   !  " $'$2!8   !  " $'$#!8   !  " $' *  $  @@ `   ``<pT"  ?# @` b6!H 2!8 c&!!8   !4 2!@$    $ $$$ $ $$ $$$ $$$ $$!C  2@ $ $$2@   2@ $ $$2@$  $!8   !  " $'   $!8   !  "$ $!8   !  " $'$}!8   !  " $'$n!8   !  " $' *  $  @@ ` S  ``<o"  ?# @` 6!HX &! ! <!o#&!   !4 2!@ $   $ $$$ $ $$ $$$ $$$ $$!C  2@ $ $$2@   2@ $ $$2@$  $!8   !  " $'   $!8   !  "$ $!8   !  " $'$!8   !  " $'$!8   !  " $' *  $  @@ `   ``<n"  ?# @!86!H   !4 2!@ $   $ $$$ $ $$ $$$ $$$ $$!C  2@ $ $$2@   2@ $ $$2@$  $I!8   !  " $'   $7!8   !  "$ $&!8   !  " $'$!8   !  " $'$!8   !  " $' *  $  @@ `   ``<n9"  ?# @!(6!T& K !T 6!T!@*   $  @@ `   ``2/ <n "@* 2*!H " !T?# 6!T !@*   $  @@ `   ``2 <m"@   sE &! ( ?2!8!<mŐ @ <!m @0•   !4 2!@ $   $ $$$ $ $$ $$$ $$$ $$!C  2@ $ $$2@   2@ $ $$2@$  $(!8   !  " $'   $!8   !  "$ $!8   !  " $'$!8   !  " $'$!8   !  " $'!*  $  @@ ` ̐  ``<m"  ?# @6!T 2"&!!T 6!T!@*   $  @@ `   ``2&!<l"@&!  <l p &! &! <!@`x!x[X&!!c0 0" 0"c0c, 4" 4"c,c( (" ("c(bH @" @bHbL $ " $"bH"bL㿐!8` Ѐ &` &!@&!8  &` ` @@  K `  ? 2!8<l"@!8   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` " &@'   &@!8 ` !` "&@? &@!8 ` !` " &@'&@!8 ` !` " &@'&@!8 ` !` " &@' *  &` ` @@   `  ? <k" ` ?# @ @Ӑ&`&!8&!@ѐ&` !@*   &` ` @@  z `  ? 2!8<kŐ"@!8   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@2!8 ` !` " &@'   &@ !8 ` !` "&@? &@!8 ` !` " &@'&@!8 ` !` " &@'&@!8 ` !` " &@' *  &` ` @@  ֐ `  ? <k"" ` ?# @ @ &` &!@&!8 !@*    &` ` @@   `  ?  <j"@  !8   !4 2!@ &`  &`&@&@?&`&@&@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@c!8 ` !` "&@'   &@R!8 ` !` "&@? &@A!8 ` !` "&@' &@2!8 ` !` "&@' &@#!8 ` !` "&@' *  &` ` @@    `  ? <jU" ` ?# @# @5 @6!F ?2Q!8 "P?!8  !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` " &@'   &@!8 ` !` "&@? &@!8 ` !` " &@'&@{!8 ` !` " &@'&@l!8 ` !` " &@' *  &` ` @@  Q `  ? <i" ` ?# @!86!H   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` " &@'   &@!8 ` !` "&@? &@!8 ` !` " &@'&@!8 ` !` " &@'&@!8 ` !` " &@' *  &` ` @@   `  ? <h" ` ?# @!86!J   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@Y!8 ` !` " &@'   &@G!8 ` !` "&@? &@6!8 ` !` " &@'&@'!8 ` !` " &@'&@!8 ` !` " &@' *  &` ` @@   `  ? <hI" ` ?# @!86!L   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` " &@'   &@!8 ` !` "&@? &@!8 ` !` " &@'&@}!8 ` !` " &@'&@n!8 ` !` " &@' *  &` ` @@  S `  ? <g" ` ?# @!F?* 6!N6!F !@*   &` ` @@  - `  ?  <gx"@  !8   !4 2!@ &`  &`&@&@?&`&@&@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` "&@'   &@!8 ` !` "&@? &@!8 ` !` "&@' &@!8 ` !` "&@' &@!8 ` !` "&@' *  &` ` @@   `  ? <f֐" ` ?# @# @d q ?2R!8 "Ұ? 2Ͱ !8   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@*!8 ` !` " &@'   &@!8 ` !` "&@? &@!8 ` !` " &@'&@!8 ` !` " &@'&@!8 ` !` " &@'"*  &` ` @@  ΐ `  ? <f" &?` ?# @`  !@* * 2 &` ` @@   `  ?  <e"@ 㿘!4``9!8  "G ` 2 ??#&`` Ȕ &`!4 ~&!4 ?&!8&!@ &`021`2  , `  ?#&`` Ȕ &`!4 c&!4 &!8&!@` ?&`0`"! &`&!8&!@< ?&` &!8&!@e!( &!8㿘 `!  <X<X    &!(&! &!$&!    @   p @2&@D}&@?`  @   p @2&@Dj&@?` &D <, ``? ? @ ` &`&``/, $`&``\`%쀢 &`\&`<RC%<S#Ԁ`2`!, `!,`< , "@ !$ , " !$ ``` &`&`  & "? 6"!00 @"!"!("! "!$!    ? hh 6 㿐!8   -</<E!x!4 2!@ &` -</<E!x &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@\!8 ` !` " &@'   &@J!8 ` !` "&@? &@9!8 ` !` " &@'&@*!8 ` !` " &@'&@!8 ` !` " &@'#*  &` ` @@-</<E !x  `  ? <dI" ` ?# @!86!H   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` " &@'   &@!8 ` !` "&@? &@!8 ` !` " &@'&@}!8 ` !` " &@'&@n!8 ` !` " &@' *  &` ` @@  S `  ? <c" ` ?# @!86!F   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` " &@'   &@!8 ` !` "&@? &@!8 ` !` " &@'&@!8 ` !` " &@'&@!8 ` !` " &@' *  &` ` @@   `  ? <b" ` ?# @!86!J   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@[!8 ` !` " &@'   &@I!8 ` !` "&@? &@8!8 ` !` " &@'&@)!8 ` !` " &@'&@!8 ` !` " &@' *  &` ` @@   `  ? <bK" ` ?# @!86!L   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` " &@'   &@!8 ` !` "&@? &@!8 ` !` " &@'&@!8 ` !` " &@'&@p!8 ` !` " &@' *  &` ` @@  U `  ? <a" ` ?# @6!N M!H(` ?#ߐ @6!N!H@"!N!N @6!N?# @6!N!H@"!N!N 6!N?# @6!N!H@"!N!N!6!N?" @6!N !@!N*   &` ` @@   `  ? 2!F<aH"@!F6!F !@*   &` ` @@  ݐ `  ? 2!F<a("@!F 6!F!@*   &` ` @@   `  ?  ?<a "@ ? !8   !4 2!@ &`  &`&@&@?&`&@&@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@u!8 ` !` "&@'   &@d!8 ` !` "&@? &@S!8 ` !` "&@' &@D!8 ` !` "&@' &@5!8 ` !` "&@' *  &` ` @@   `  ? <`g" ` ?# @b6!F ?2U!8 "! &!<!X`O!F!<`J! 2  d26!F6!F  !F!6!F !@!F*   &` ` @@  ͐ `  ? <`"@ ̐ !8   !4 2!@ &`  &`&@&@?&`&@ &@&`&@&@&`&@&@&`&@&@!C  2@ &`&@&@?2@   2@ &`&@&@?2@&` &@!8 ` !` " &@'   &@o!8 ` !` "&@? &@^!8 ` !` " &@'&@O!8 ` !` " &@'&@@!8 ` !` " &@' *  &` ` @@  % `  ? <_q" ` ?# @? @ 6!T !@*   &` ` @@   `  ? 2 <_K"@ &!@H x&!&!&!M&!㿐!!x`h   Nh !4"2 "&!4V!4  ?#$ Ȕ $!4 &!4 %@@ ` )<S 캐 @  ? 2#<_!#Ԁ ?`?#$!4` ? $!8   ?$@ $@! 2?$bb    v b ``<^ $cc    b c `` <^  $b, $b$b  *` #$bP  *`@$c  *  $c *`@$c !`P?`t @ ?#$cL$cH$cD$c@L D;n `p#  2? 62! t@+    ` ? K    2`@: $K2`2`*  `-  0t@ޘ$cL$cH$cD$c@ $c@$cD$cH$cL % (%!<   %`%`!%a %, %`%% <^!<"^!`P!((@ $c !4*  "d$b !4  "!8 "`$@b `$b c $c   㿐    $  ` 눐  ``2?<]Ӑ!?#$ !4`  ?  $ Ւ!8    0$ $ !8   !4 2!@ $   $ $$$ $ $$ $$$ $$$ $$!C  2@ $ $$2@   2@ $ $$2@$  $!8   !  " $'   $ !8   !  "$ $!8   !  " $'$!8   !  " $'$!8   !  " $' *  $  @@ `   ``<] "  ?# @!86!H   !4 2!@ $   $ $$$ $ $$ $$$ $$$ $$!C  2@ $ $$2@   2@ $ $$2@$  $r!8   !  " $'   $`!8   !  "$ $O!8   !  " $'$@!8   !  " $'$1!8   !  " $' *  $  @@ `   ``<\b"  ?# @!H(6!N` ?#ߐ @6!N!H@"!N!N @6!N?# @6!N!H@"!N!N 6!N?# @6!N!H@"!N!N!6!N?" @6!N !@!N*   $  @@ ` Ð  ``<\"@㿘?=" !<"@\  !<["x  !<["  !<["ؠ <![ߐ# <![֐#H <![ΐ# <[Ȑ#<[#"<<[#<[# <![#  <![ #<![ H <[#<[ p<[ "<<[ <[# 0!<`< <  [p   2!  <[f '  㿐\?" @ &  E 2&  @<[E!8`  4 2@ $   $ $$$ $ $$ $$$ $$$ $$ C  2@ $ $$2@   2@ $ $$2@$  $8   !  " $'   $8   !  "$ $8   !  " $'$8   !  " $'$q8   !  " $' *  $  @@ ` V  ``<Z"  ?# @84F   4 2@ $   $ $$$ $ $$ $$$ $$$ $$ C  2@ $ $$2@   2@ $ $$2@$  $8   !  " $'   $8   !  "$ $8   !  " $'$8   !  " $'$8   !  " $' *  $  @@ ` 笐  ``<Y"  ?# @a 4P<Y!(F !` <Yߐ!XF@4F`@ <YӐ!Fa4F<Yː! @F*   $  @@ ` c  ``24<Y"@4 ?#$   Ȕ $ 4 G$4@.@(( %, `&"$(, @ $@p\@$@覞28     ` $, `, $(@@ -`2`; @-; $ $-̐ `$$! $`%%@: &7ے "` `? ? @   $ $ "`% $  \% e쀢 $ \$ <^7% - "  ! ` $ $ & `\58`$`\/$`7     `$ $ 2 `$    \ @ $ $ \$ <_h7O`@ބ `- " !& 8*  2,`i ,`iRϐ4`tB @$$ - X `$<X!$ "& ( @4"@?ဢ@< & ? <D""`$"D& 㿐`\?" @ &`  ~ 2d&`  @<X~!8`  4 2@ $   $ $$$ $ $$ $$$ $$$ $$ C  2@ $ $$2@   2@ $ $$2@$  $8   !  " $'   $8   !  "$ $8   !  " $'$8   !  " $'$8   !  " $' *  $  @@ ` 叐  ``<Wې"  ?# @84F   4 2@ $   $ $$$ $ $$ $$$ $$$ $$ C  2@ $ $$2@   2@ $ $$2@$  $A8   !  " $'   $/8   !  "$ $8   !  " $'$8   !  " $'$8   !  " $' *  $  @@ `   ``<W1"  ?# @a 4P<W#!(F !` <W!XF@4F`@ <W !Fa4F<W! @F*   $  @@ ` 䜐  ``24<V"@4 ?#$   Ȕ $ 4 $4@@( (* @ 2$(  ` $*@ "$(@@| ,,`k0,* * 0@*  @2 `;``; $ $@"̐ `$$5'     `$ $ 2   &$ ` \@ @$ $ $ \$ <ah4ϒ `PP\4 t@x @$$! %% ,` $<V<!`$ "&` ( @4"@?ဢ@< &` ? <D""`$"D&` 㿐\?" @ &   2&  @<V!8`  4 2@ $   $ $$$ $ $$ $$$ $$$ $$ C  2@ $ $$2@   2@ $ $$2@$  $t8   !  " $'   $b8   !  "$ $Q8   !  " $'$B8   !  " $'$38   !  " $' *  $  @@ `   ``<Ud"  ?# @84F   4 2@ $   $ $$$ $ $$ $$$ $$$ $$ C  2@ $ $$2@   2@ $ $$2@$  $8   !  " $'   $8   !  "$ $8   !  " $'$8   !  " $'$8   !  " $' *  $  @@ ` n  ``<T"  ?# @a 4P<T!(F !` <T!XF@4F`@ <T!Fa4F<T! @F*   $  @@ ` %  ``24<Tp"@4 ?#$   Ȕ $ 4  $4@.@(( %, `&"$(, @ $@p\@$@h23F     ` $, `, $(@@Ͳ - `2`; @$- ; $ $- ̐ `$$-  $@,+k !%%@@ &2 "` `? ? @   $ $ "ڲ`%@ $  \% e쀢 $ \$ <d2B%- `, +7 -  "` !  $ $ & `\;8`$`\5$`2Y     `$ $ 2 `$    \ @ $ $ \$ <d2`@: ,-  `*-  "`!& 8*  2,`i ,`iM4`t= @$$  -  F `$<Sb!$ "& ( @4"@?ဢ@< & ? <D""`$"D& 㿐  @`<S;!8`  4 2@ $   $ $$$ $ $$ $$$ $$$ $$ C  2@ $ $$2@   2@ $ $$2@$  $8   !  " $'   $8   !  "$ $8   !  " $'$v8   !  " $'$g8   !  " $' *  $  @@ ` L  ``<R"  ?# @84F   4 2@ $   $ $$$ $ $$ $$$ $$$ $$ C  2@ $ $$2@   2@ $ $$2@$  $8   !  " $'   $8   !  "$ $8   !  " $'$8   !  " $'$߽8   !  " $' *  $  @@ ` ߢ  ``<Q"  ?# @a 4P<Q!(F !` <QՐ!XF@4F`@ <Qɐ!Fa4F<Q! @F*   $  @@ ` Y  ``24<Q"@4 ?#$   Ȕ $ 4 =$4@.@(( %, `&"$(, @ $@p\@$@20z     ` $, `, $(@@ -`2`; @-; $ $-̐ `$$! $`&& @: &/ђ "` `? ? @   $ $ "`% $  \% e쀢 $ \$ <f/|% - "  ! ` $ $ % `\58`$`\/$`/     `$ $ 2 `$    \ @ $ $ \$ <g/E`@z `- " !% 8*  2,`i ,`iJŐ4`t: @$$ - X `$<P!$ "& ( @4"@?ဢ@< & ? <D""`$"D& `,`` ?\ a@ >& r 9 & 㿘 \!4 @@  <S!* !a."#Ԁ  <_< a @䑘 < " 2<\<a< c\< bd @}   !<@^ "PP<?0 㿘 \  $@@   ѐ @  ? <P!x     p @32$/$      p @ 2$.$ ?%4 @@ " ݒ0* "@ 㿘`\`$ @" ! 1<!@`H" ''<@O͐"!`$!<"a ` b O@ !@&`$&`H!(@?ဢ@"2  \"@ 2 \* +  "  +  h"@ ?* 8 @ <@" $! &`H  "@! !(@4"@?ဢ@2&`$  &`$ 㿘`\`$, 0!<!@`H" '<@On"ᨐ`$, !@ &`$U&`H`$ @ޔ<OY"I ( @4"@?@ ">  ,`, ,  \,  @,`h"@ ?8, @<!@`" `$ &`H "@ p @I2 .' (@4"@?ဢ@2&`$  &`$ 㿘`\`$ @=!<!@`H" '(<@N"a`$a<@"a``  b N@ ﯐!@&`$&`Ha a(@ဢ@"9  \"@ 2 \1 ,`" a, a* &7 `,h"@ ?`8, @<@" $a &`H` "@a a(@4"@?ဢ@2&`$  &`$ 㿘 \ ː!㿐`\;n  `p`$ @Ȟ`P?`t@ ?"L"H"D"@F&`$ @" >&`$060`t 6* ` @? J  0>  $J00()2 &ߐ`"L"H"D"@&`$㿀"! \`D;  @ۺ    ?耢``"'///!8    !4 2!@&    & &&& & && &&& &&& && !C  2@ & &&2@   2@ & &&2@&  &ۈ!8   !  " &$   &v!8   !  "& &e!8   !  " &$&V!8   !  " &$&G!8   !  " &$ *  &  @@ ` ,  ``<Mx"  ?# @!84!F    !4 2!@ &   & &&& & && &&& &&& && !C  2@ & &&2@   2@ & &&2@&  &!8   !  " &$   &!8   !  "& &ں!8   !  " &$&ګ!8   !  " &$&ڜ!8   !  " &$ *  &  @@ ` ځ  ``<L͐"  ?# @!F@4!P /!P !   d`d7!P!P 2 /!F@  d7!F2  /D @-    .?, *?\@ !! `?    d ?  ?;!x { ?Ӂ㿘 &  &  $& & @ֺ4`@ӧ`  " $`$@`㿐(  h@. ?    ?2 <#$@ Ƞ? @  ѐ ?2 <#L ? " f? $` $($` $`$`$`$` @Г$`$`$ $` `$ "  ` $`,`, \$`($`0$`4. . . . . .  .  . 0   .  .  .  .  .  . . 0   . ?. m!|#  @ 2?? pc  "? <K   /@㿘 @  <K 0 D`& D@ <K X D t` & D& t@ <K  D `& D@ <K  D  T` & D& T@@ <Kz  D `& D @<Ko!@<Kh!(@  D T!a& D& T@ <KW!@ D  p` & D& p@ <KI!x D `& D@ <K>! D  p` & D& p@@ <K0! D  p` & D& p@h @ T!a& @& Td @ \!a& @& \b @ l!a& @& l <K ! @ \` & @& \a <J" @ T` & @& T``@ @ d!a& @& d` @ `!a& @& `<J"( @ H` l & @& H& l` <JӐ"H @ X` & @& X` `<JƐ"x @ `& @` <J" @  l` & @& l` <J" @  l` & @& l`W 㿘   ,@ b $ * @*`@*`@ ' ?*@ @ `;   @ X  H`& @& X9& H )     `$ $ 2  H && H ` \@  @$ $ $ \$ <m(Ò D DP4 t4l 0 8 @& 0& 8 b %% ,@  &  <J/"㿘@ cߦ , ` 5  `$ @`c 2$ n$ ,㿘 \ #* , 㿘 \   , ?  ט ? <I#0$@ Ȱ? @  ׅ ?<I֐# @*` 2"4 '<` `"4@ "<*` "4"`$@4"@"@<0 <D `$ D㿘`\  $`$ @ƞ!<!@`H" '<@I# 5!@&`$&`H  @4"@?@"F   2 ?  `*   \, ,`h"@,  @@ 8h"@  <!@`" `% &`H "@ p @i2 (G  @4"@?@2&`$  &`$  \ 0㿐;n \ p$ , @UP2t@ .    ?(0NL  060t 6* `  @? J  0>  $J00()3 &ߐ` .    ?(< (*,( &$ (;0("@"`D"` D0"``"`㿘  $b b ?  ; b ? ? 2  <H"<b H"  &# #   ! #  ? <Hm"<# Hi# (`c0 0" 0"c0c, 4" 4"c,c( (" ("c(bH @" @bHbL $ " $"bLbL"bH㿘 `(  <X<X $ $&($&(&( &(   @   p @K2&@')&@?`  @   p @82&@'&@?` && +, ``? ? @ ` &`&``, &`&``\`%ꀢ &`\&`<pH&W%`, ` "&`"&` "@ "$   $А&  " " ? (,  @"("($"("(     ?f   ?㿐(4  *  <*   '&`'0G#@㿐(4   ' < ' &`'0G#p 㿐(4   ' < ' &`'0Gn# 㿐(4 <Gd#0D.   '?&`'?    (4  `?4@ ?4@ 6 ?6 ~ 6 > w>㿐(4  <G#1?h#   '?&`'?X T P L (4  `?4@ B?4@ 6 9?6(4 ] YV *?NKH,/ +( *? ,6 㿈    $ "?$ "?2$  $ ' $  '<   &(4?$'0? &(4$'0 <F < XF{ 㿘(B@46(B   6(B   @  ?? 6(B (<FP 0 ?Ȕ* *6(B2ٔ  ?㿘(\ (X  `>&(\ 6(@ (@ 6(B(<`< < ؐ F  &(X% (\ ?2&(\(<F @i <(E!0  (<E!8 &(X&(\`<!@`x(D4h&(L㿘 Ŕ 6(@ 6(B k 6(B d  @%<'<qq ?   6(B (<E   *6(B ?2@ `x&(X&(L&(T(D&(\4&(P㿘Ēh, Ȑ %?   / ?<E"ѐ<S#Ԁ`0.ʐՐ ( *  $#   *`@ $#  * $# $#@$#D$#H$#L$#  $"   *` #$"P$!$` ($` $`$`$$`  $`,`,$`($!$`$`$`$`$",$`0" `$" # $# J㿘<E)!x` ``<E!!`<E!  >6<E!<E !<E!<E!@<D"<D"<D"(<D"@<D"P"<<Dې"h<Dؐ"x; 㿘` `@h "`    + `(h$h#,  @2&h$d, @ $@`p@ʞ2hd# hd h  ` &hd, @, &h$  h`-`` '`;-`hp-`h` &hp&h`hx  &hxb%z%`@`; &#  "  `? ? @   $ $ "߰ $  \hĒe $ $ \$ <sĐ"% -`  "$ "$   "`"% \@(8h$\2$`"Ւ     `$ $ 2   ` \@hĖ @$ $ $ \$ <s">a -`  "`"% h>4t.!h` &h`` -` l &hh<C"h $`"" h$h@4"@?@< hĀ? <DhĐ""`$"Dh" 㿘` `@h "`     `h$h (*@ @2&h$hd  ` &hd*@@"hd&h$s h`,h(`bh, *` *  *  ࢑*  @?*  `; hph hx`&hp&h6&hx "     `$ $ 2 hx #&hx ` \@hĖ @$ $ $ \$ <t! =h=I4 t-eh` &h` " `%@,%``&hh<C+"h $`"" h$h@4"@?@< hĀ? <DhĐ""`$"Dh" 㿘<S#Ԁ` \<t< `<s< `Ⱄ @2 < B"?$(D$(HU 㿘 \ 2D $X$\G   p @2$!$      p @2$!$  կ 㿘`$ !`\#<a@`H" '%<@B"(t`$(t a@ p&`$&`H @Ѿ2J !F `$ @Ğ<@B#9 (($@@"@ (  \h"@ ($"    h"@  <@8 (" &`H  $( "(($@4"@?@2&`$  &`$ 㿘`\`$( ,!<!@`H" '<@B<"t`$t !@ &`$Y&`H`$ @b<@B&#L $@4"@?@ "A ,`, ,  \,  @Ǵ,`h"@  (" 8<!@h`"@ `$&`H "@ p @2 $@4"@?@2&`$  &`$ 㿘 \ n(`㿐 \;n  c #  p ?$# # `"  Pk #  Pb? t @?#$#L$#H$#D$#@0Ba#  @$# 0; 2? 62 t @)  ` ` @? K    2`@: $K2`2`*  `+  0@&ߘ`$#L$#H$#D$#@#  $# 㿘-<&   ,    ` @ "`@@S 2   ` @ "` @@> Ԧ 㽘<'<&""`؀ L 6*`"`2L` " H )<` @#"H@2@`&`,, #"H @2㿘 ?& ` @ x! @d  ` X@\   ' p2  "@P  <@# $` P" "P" ""  @`  (@@ 2@"@" & ` ( @ϫ`f D <@ @ #\#`#d@ɚ t €쀢<'"```" @` "@@@`2``$ %<`$`"@@ $`" @@  P(2@@L@`2`$@ ]`O` `" @` "@@@`2` ? ; < @ 0%<' p2  " ?  d` @@8'' #\#`#d@P쀢 2  2  <@ * p D( < @ @`@@2@` `@"&  2" 쀢 `@| X`@w!  @p"    `` `2`  P@ T *@d* \ P,,,0` $ $P$T,.////// ?%%  - @ - A % - B'''% H/  #\#<w!`0@"XH*/  @΍!`% :` 2 ̀`| ̐ p pw ΐ    n k?  //#% .////- C'''% Ho` #\!0@O ȑH*/  @:Q! % @* :  "+  `-@?-`  `?-@-`` @ĝ2` @ę:`  @ĕJ `P2`* *`  $P @2   *$PP$(2  a > 1$P @ ` <v"<,  €P  $PP*@$P< (>TP* ?$T$P4 `  `  `? * ??@  c *  $P,0@<'"    `"@$@$$ 2  `   ,12 P `  2P`,1PL1 ?π` $P `   @$P,N `P ?$P`P $P=<>Z @P? ~$P  . *///#% ///- C'''% Ho` #\0 *@^ ȑH*/  @I h% $ X@  '@<> `8 P  `$$P` << @  @@ 2@"@$$@ & '&  & ` р   `   㿘` <;Ӑ " `P?2`P<;ɐ ` "  ?+  "  ?2 ! ??`# @  @ 2  A`@ ?" ?2  2 @" ` `H   <& ؀ 2} h`"p, 6u p2  2p ` `T2  2h K 8@ `  (`n`    $ $ "  2 "@$ ` 2`  $  2 <  ?< <i& <$ ("<   ("@& 2 $ $ $ ?<i$"-ؒ #?#& &  `(@16 ~6 |& & . C`. B`` . A`!. @6 6 㿘  ` <;! 2  ?  <X<X !` `H <& ؀ @ `h"`p`,  `p2  ܰ `+<`T2  +<`P ` 0  ?+ (  ?" ??`# @  @ 2  A`@ ?" ?2  2 @  ?"     ?$``?.`H/ `P․`2`P`a8`+$`P/ ( 2 " `PN@ </  H `P2` d$`P&!` <2 ` `.! < Γ2 ` .  ! T     "   #p`%D;@D  ? @  @``  `@ް?ꀦ`ٰ?  `  >4 ?@ے   <#h2` D   ?   D @` D @@逦`  `* @/`` #  `#    #p!0!0 H/` 0 '''&`<#\"X  @Ha &`D  D? = `̐@ aD  D? +" a @aH/`` # `!   㿈 (?@ !?c@" P4c`"  ```"  c@" P @"f\ cc@c@"H\ @kc@"-D D;D  ?    $`  *  *` * & ϰ   `&ɰ ;D  ?     2& @ !! `? P`@`  , N$ P @ !! `? P @ ?$ P, N \@ !! `\@ !! `n?@j! @@d  *  //////# S! @@M  * //////# =*`//////#x / *  ///p///g   * //p////V   $`$?㿘D!D!Dn3@qV@ii@㿘<!,㿘 <#h2`  <%<,q &<,j!㿘> <!,b `㿘`̒ 2  X` ` 8 `2 `<,L! `< `*`* `@ * `@ @ ,?! ``<,9! ` @<,3! ` <,,""<<<""" <,"(`!<"0 @ `, ``` $< ` ` ` "<<,"H<`!<Ҡ"0`̒ `+<"`+ <+"  <1< @+! & @<+ߐ!㿘 @ ` `  %< @+͐ & @0 <``/+!  < `<+" +!㿘< @" A+ 2<+"& E㿘> <"+ `㿘<#+6 㿘.`2 * ` +$ 5?@0`@   @  @ ? @ &&(@?c  ? &&@@& 㿐 $*"U@ ?   "   * @@   `B? ` ? ` `* 8@ 5@@`@  @` @ @$@@@@@#2?2?'&@@ؐ& ?㿘!>@͒@  $ >`@d$@@  @U@"?&@&&CdC@CdCCpCCCCdCCdCCpCCCCCdCCC4BCdCpBCdCdCpCpBCBCDTD0DTD`D`D`D`D`DTD`DTD`D`D`D`D`D`DTD`D`D`EEDDEEDEEEEDEEE㿘 h < X<!@@ X& `& h& d㿘<!@ ` X& $ h$ d㿘 !6 & & 6 p &p.0. , .   @VB㿘H/` 㿐 `p 6H P''H`` "`'"`  )<X#<X%<'<!  p`  ` @' xH` `2"`! P6  㿘H/`!& 6 $ 4`?@?#!& 6 `  @˞0<)!P 㿘?!& 6 & ` @㿘?!& `6 & ` @ ̄p0`?㿘 p E@   & l |& T D6 ~ ,@. C 㾘<'bȔ @ E A*`, F$`2  "ג   <)E!x13  @!@ E<#h2` !$ T, C$ l4 ~@#  l@ϔ  Œ" p @Ð E $ l  |$ T D4 ~ , C㾘<'bД @ E A*`, F$`2  "   <(!13  @8!@5 E<#h2` !$ T, C$ l4 ~@^#b  l@}  s" p @q E $ l  |$ T D4 ~ , C㿘  @Ȟp<!@<@''''''''H*/  @H/ 㿈!6 h`<#`& <t'''?"`#& $<,a4H*o` @yH/  Xy"` @2 $(@&!@*   &  #``@@" & `@ & !82 ̀"  ̄pp2   ΄   2``|"`<2`~"㿘 & $ 4`2    !6 $4@ 㿘! & $ 8`!  6 $8@ @"&  㿘 !! 6 & & $ <`# @ "& ! 2  "   B @2T  "T2 B 㿘 !! 6 & & $ @` @ "& ː# 2  `"   `T  "`T@`2`T 㿘 `P2  "?1 !` C!<!,*` €?*1$!<  E * )14  ܀  ?#$ @a*: "1: `< ؓ*` €1 @L " $01   $ (  $ $1 1 㿘  ܀  ?1"% @% ! 1:`  :` `<!\*` €@   1 1 㿘a 2 1  ` 21 ``<!*` € T2`  *@1"T 1 1 㿘 ^ #     " 2 㿐 `'` @` 2  2`2` `"O`8 20  2+ '@2#   .2.c2 42  .2.Q 2@`2` ` `@ 2 `2` . v `2` "+@ @2" %0`2 2  " 2  .2.  2 @`2` . s  `7`  `     2   `2@А2@ "@a2 @.2.@`2` . 6  ``"@75@@2w  %   B B@2  @ @ 2  P @ 2  d` 2 B22K  "G  >?߲#/ B B@23  @@ 2+ [@@H @@ @.2.R@   P # P.2.D 2 B2 2@`2y` . "  `h `"`@7@@2T `P @f d`2E  "A  8?-#/ 2+ @@ڐ @|@ @.2.@   P # P.2. 2 2 2@`2` . 2 4 `*` "?ߤ## `@@2  `P "`P.?2. @! $! 2 @`2` .  <"! p *@ ' p<'$<􀤠2<㿈'''6_ !d!l5ސ!<8 %t !t@x6%p !p@o!8?""< 2b(@’& &   @[##H/`    $& 0`@   @s&   @A[  p c  & p& & ` &  @Mϐ@ǐ=@S@f@(@E@y@}@@R|RRRSSTpTxTTTTTTTTTT,TTTVVXlWX$WWWXlWXlWVWWWWVWWX$U|WWW@WWWWW\\|\`\\\b8`` `h``bP㿘H/` 8  9& <!$* €@  6<2"#N!@  *<2#0 B#A! 8 `. 8 8 <2#x#3! 8 `. 8 8 . 8@$<2###!<# # 㿘 ܐ`$& @ 2<' b@ E ̒ @U E< Ach2*  @  . F& l& T. C. I6 ~&! `̄pp`܀ # !  `΄߆ "`܆ <<(  ` T0(" T 0 㿘!& & @c <     `?,*` &! ܀ @ <2" (0V< | D6 ~. C< `<!̓*` €<  ܀` ` & <2 p B  @" AN ' < T<Ò `G<!x*` € ܀ # ?& x "  w z<<r 0t<<z<<Ð `"Q!t  p U "b L 0] f 0\<2  B"9 @ Y <<Ð!(`ؖ "-"P  '!X ܀`  E  2 A & 8` & . 8:  7 '5 % ܀  ?& ܑ< 2( <  2#   "  0   0  0@       (ː   D " $  O<H<* C<G   (@& $: @& 4 <!@8z$@ ,  ܀  2< B!!@  "  ܀  p  @H E @  D&! . C & l |& T6 ~D <Ð!Ȓ`" 4 , ` H?5 ,  ,  <&2 "`ؐ?* 2        # H2   #, |&! D6 ~ . C€㿘  @ 8 H*o`0 8 H/   8`, 8@Ȓ 2 ܀    P`< B! @! A`, 2 8 `, 8?<`2"8! B @! A E  @28 4 `$D@`+<!*` €`' 8 ܐ , 8`  `$ ܐ@ , `@| 8  8 `, 8 @p 8  , 8 `` "@  T  T 2 @`2`  "  B 2  T  T 2 B2㿘<`2" B` @  8 H*o`0 8 H/ ހ` 8`,8@ 2` ܐ @$`, ",`H` '<  " ?"  ܐ &   2 @ `$$`8$`4H`8@"@g- @*$`8 1<`, 4`,1<!@ $`4$`8ܒ $`$H€`8!@ !@0@<`H!@$`8`H  `,?4`,  ܐ ?$܀`<"*` €"!+0 " B>0 T  "T 8 ,80|"!v " B&o  T  "T 8 `,8` "0!" B 0 T  "T 8 `,8!` @   " ?" ~  2 * ( ` $  " ? "   B B@2 ]  2   8 `,8@  㿘 \ < !@ `"@ `<0Ҕ$㿘ސ U@ , 2 p] N p $ p  @&   `2 J ;  2  &  !6 6 & <   @-" @-H`  `" $ `< `"$ "`< 㿘 p2`  *@`U& p`  V6` H` `* V U `<` 6 ` " ``2  "  p2  `  2$`<&  "`<  ݀ 㿘\``!?`   !<ğ@ @;<Ē`@56$ $@&&@㿐<'"! #\#`Œ!A2 $ " 22?㿘<'䀣  2``  `@=  `@G & 㿘 < a@"<]c2& <' 2! <'"< b2"  !'<$2( H儒   H< @<2`DaA4@2@4`$`4` `@a@$`<]c1 12$㿘  ` d5  .$ d.  & dڐ . && & "N@ @` 2 `.@ `."@``N@ @㿘 ` d?d 0d`J` 2 `` $`J  "``L ` d?d0M` . J@,  K@J "` @z  L`6` ` `J@J2 ` ` $`J`"`K  ٚ `J` ` $`J  `&@`J@`$`J`  2``* $`㿘 < 2a @    @/<Ĩ 2-<+<M@Ȓ`@Ēah``@<Đ@ap : J 3<)<L@a`@!h``$L<Đ@a )<'<M@@!`@h``$M@@<ĘaN 0` <#x*` <Ĕ! @{ N 1<Ġa @pN 1`<Đa@d&㿘 cȰ?cƐ㿘 ` $` !<`s"`%<"+`(`( $ <$`( `2 " $` `2  $` $ <2  @€& `(   `2 @$`$`q؀ `( "`$ $)$` ` @s `K2 `H #<i  b   # H2 b  #  #  F 㿘 <Đb@ a0@  @ a<Đb@ؔ `㿘 *<'  2  p2`  @ 6?,`<' "@*` "? B `P "  `P* @`P2 `$@J *@ ` "W? `  ` M?*`   P2  <B * 'b* `2 9?   (   @  *  ( "(`  $`` @  ` $` "`" ` ` @ ` "` 㿘I * *<' `2` `p2 @, * @ `(?"(``P2  , `(  ,  @  , b* @ ` $``` @|b  ` $` "`<'" ` ` @i ` "` <'  @<<' " " `@ 㿐!  2   2  p2ڐ < J  ??c<  B <'3` `2  `p@*` *  Ϙ Е* ї* *`   Җ  2 ` +   `+  ";  <*` ሑ*  #    I ~ @   " ~ 2 @[   ~`@      @ "   2  @B      & < # @rЀ$ ~` @    " ~  ~`@       ᛐ k ̐  p2   ΐ  2  <' 2 2 p * @*` P2` d"PG@)0k 2.  <'2 2  p* "* @`  E ( *  ؀  22 `p@ *` b*  *@"@  ΀ <2#8 B @ A{ E<Đ#혒M @$<' 2 2 p * @*` < #x2<`<Đ#t ) @㿘-<l,# ,`@?`2`<'""2   ?* 2  (,<#, ( " ,  2,<#<'` 2 2 p * @*`   p`|  T , P2 %<X<X  H*/ c뚔  T @$ TH/ , $ T  2 , `2`3  `p@ *` *  ? 0<' "`,,    22 p *@ *` U `0 2 ? c, 0"c,$`0@ R,x  ?2 ><'2  b  * *2 * @  .<' "@*` " P0  <+` a*  `@ ( U@O3`b d2b䀍`< < :b*`  2b䀍`< < 'b* @`2 `< < 0 ``<b* @`P2    ߒ u/ /y X& `p2    J`0 @    * 耢 <   <  $$@@  ߍ    "v  n <& Ȁ`<& Ā` b䀢e<& Ȁ`a<& Ā` ]<+ pZ b*`    ?#  4 2` / "n$ $@ 2np2 "n J 0` 2 " @&|?n, <5 @ 2` @ը ,2 !6 ~ >6 `n4&ː  <Ґ  6 ~ @ ~  O L@  < $$@`  $` 2 4 $$ 2/ ~`p2  ") ~ J 0`"$ ~`` <& Ā` ( ~ކ  "  ~@`$@6 ~ 6 ~ ~` 2@ ~  n (3 <& Ē  <Ŕg <Ő!a #< %< $a@Y  < 2 $ ~ 8<Ŧ <Š P E ~  <<!` 2 A 6 A `" ~@  ~  Ab* *@/`2b䀍``<!"=`<!<`b*`  2b䀍``<!"=`<!<`b*`  2b䀍``<!"=`<!<`b*` ``-`,`` ?#@?` ?#@4=` =`=`<`//////// /=` ` =`/////b*`  ,` . Cb&  &  @.<#L J 0`+!L #\”6  <' p2    <#<'* b* @` 2 P<}!, 2 2& 27*` b h  @ b @*` b `P;6 "`P   @*` b Pd"P㿘 ?& ` @VH<'.`b@,  P2``H/ '    "'?' #  /  `*/@M ,C,,'''$$ฐ <#\b"+H*/  @H/ $฀`   ΀  䀤`o*` P2` `g` ΀ c` B<Œ! /@`  *@/ /,C,,'''$$ฐ <#\b"+H*/  @AHo`<!@$ฑH*/ %<Š  d! dHo``  <!@?` ,E  `<H!<C"?* c  B` %/@`  *@y/@v ,C,,'''$$ฐ <#\b D+H*/  @/H/ $฀`?`7<` #\<ŗ<`<`<`"  ` " < <Ő"h <Ő"ܒ<Œؐ"* c"""P2`  ΀ d"P*  * *` * @ *@ @`"  *  *` *  ""<"" (&$!<Œ# `P2 2"<~#H@@` #"   v*` `.``5<ő( <B" (*  #@ * @`(  <B", "* @ő4` 2  d@i 2@f +` * $#\h, @ * " h2* " d2* " a2 "*`* @`P2 "f ` "b@>  /@`   * ///,C,,?#'''$<$ฐ #\b"+H*/  @H/ ` $<Œ#@*` < 2 * @ ` < <Ɣ   #@ ז*  @@ "Ò"H*o`㿘<'" <'b䀢  (*   *<'c $  1<#<'   @#v]c  <Ɛ    @K 0Ѡ  ,`:  $"䀢 °   * ھ*  #<B*@ *`@w%"  ڳ*  <B"@n*`  ڪ*   $b*`ڤ  <B""`)<'b$" "@ "@  * `<' "<B<B" b<<j @*  "@ b @*  "@  : 뀤   ** g*  <"a : ` *` * " * Y9 %#|<'"<B#<'c|<<#<'< ሒb"   ,   c| @" " """("$""" """ @ ,,`,  `: 値  :`*` * " #|*    ?" "  :`*` * " *  "? <m!(㿘 #<' <<l  ! @*` *  * # <  "  @*` *  <* b" b ,`: "` <'#|@ ``(`@2`(`b  :`*` * <'|" "*  "?#"b  ?<'%<', * @ 0b@  *<!`2  <B", :`,  `"@*  * 2 h@ , , * @"b   ȑ, <'"<' b <ᐐ @*      n`2 x @ `: 뀤 㿈N 0  <'! <'b ` *` z P<Ƒ2  `8< x<Ƙ   `2   #\  㿘H0  D <'"  @  $?8 $<' " <<'` 6b` 2 b `&+ <p  * ༒@ `*"`"` `  `+``:`*` * " |*   `" 㿘 6 2  p<'. *`   Pb2((<'(<8 e?#|b"P  ? 6. *`  * *`: ` `@*  * 2 vɐ`xʒ c|<B$"@ⴐ"`" (2"Ԥ* c|-  * @"` ?:`*` * " * *`& a @`P ="P㿘. 2 | 㿘<'"<'  db<'7#Pc `2W`5<' - ? -7<*` * *`: ` `@*  * 2 ?vO xP |<B"@Ⱀ" "@?ܦ`%@ %`%` $ ?@ & $& ``?.`.`:*` * " |*  " `+@#@&h@@/@o@㿘 ` $` !<`s!` %<"+`(`( $ <$`( `2 " $` `2  $` $ <2  @€& `(   `2 @$`$`؀ `( "`$ $)$` ` @`ё2 `H #<i  b  # H2 bz #  #v ̐ 㿈`*!<',`2 2   `2 **@ "*`冬"䀢 X?ba"\b^5 )b] `94`b_ߐb`r `04`bh"D bbbc `"4`"j "k `4`!?D;  ? " ` @ ''2 ' $`P D `42  `p@*` * 㶔DD. . 6 B<`* g*` ሑ* &ϰ ̰?D;D  ?  &<`* * ሑ* @`& \@ !! `?`**  532 <!*`"  ?D;D  ?   `*<2 a* @&} @ !! `q?`* k?t| `*vv 0d\@ !! `*,`2 X S;  <a- @ `* &0DC?`*A=\@ !! `2D.?;   ? !?,`Ƒ2  D@  ;@?&02 `p@ *` "* !i@㿘 ` $` !<`r"`>%<"+`(`( $ <$`( `2 " $` `2  $` $ <2  @€& `(   `2 @$`$`؀ `( "`$ $)$` ` @s`}2 `H #<i  b  # H2 b #  #  㿘 !<* *  !* @` @ ͒(s  *` * ! *  ("( * *  *  `  $`` @֞ * *  !* @`  $` "<'# ` ` @ ` "`㿘#@E?` !<* @*`@!*`  ߪ  ` * *  !* @`P$("P` * *  !* @`P ;2 "P@ `  *` * ! *  (@ " ` * *  * "㿘!  =  I  ̀ F ΀   >  Б*  ѓ*` *     2 `$ +  <*  *  @`"*   <B <B":  @ *  ጑* "@ a+( i ~`-   @I,  , @@ 2 2  (  "  <"  $2   $$@pd  ($ @    "  ~ "@\   ~`@    `2 8   & < #  F @ڞ⼀$ ~` @    " ~ӷ  ~`@  ӯ     ӥ h  ̐  p ΐ `  ` <* * ጐ * @`PdK"P ` %  < B#(<ƒ"< ;#@ߺ E <*` *  ጑* 2` *@"@w0L$  < #P <2# <2# B @  A߈ E<Ɛ"ߥ @M"< * *  ጑* @`<`  2 ` `=  ``<Ɛ"߃  @+㿘o7 <'# ` * * !< !* @` "Q? 2 J?*` * ! *  (`"( * *  *  `  $`` @ * *  !* @`  $` "` ` ` @` ` "` . * !* 2``" @p 㿘3<la$X# /<X-<X$X`@?`2`<'"#2  "`(< T X " $X  2$X< J x< * *  ጑* @`  p`  T ) P2 "  H*/ cM Ho` T $ T $ T$X `* *  ጑* @` <ǐ @ (`  `` $X ` + @ *`@ ጓ*` `)<' #`$ $X0  *` * ጕ*  "`<i? `adX 0"dX$0` <i"e #@M$X㿀  ?<'7 #   @ # -` @<*`!@*` 2  P2 `$2  ``2<Ǒ2   * 3 ˰/ (/q  A* /6 ~`n <& Ȁ`<& Ā` ( ~* a* @` 2 #/ 2 2`  n 2`  (<   n 6   ?% "@ "*`   ?,2 !6 ~ > 6 2 <  ;6 ~  *  & &<!&  ~( ,@5<ǀ$$$ $  $"" ~ <ې!8 ~<`  ~  2  2  " 40  б(  ?* a* @`2 5 , * a* @`b:, ?#(a@2` a5554 //////// $8$& &  @ <#\b̐͟+㿘0? <' <ǖ`* ! 2 `  \0 㿘 `0? 8 <'#  @ <`$?,#`$ ! <`T 6` 2 &*<,! * ጐ * #`@"`    @ + <! 㿘 ?& ` @pH/ ". * !<!*   H*/  ت3<"@. @* ጑*  %@/`  *@/?c$,C@ '''$H/` #\"cښ+  @ʞ$ ¬ #H ̞ @* ጐ* c# ("_" @ *` * @ *@ *ጒ@*`#  *  *` *  (#   "+@, )$)0@@* ጐ* @("`@* ጐ* *`", ጡ,  <@! @"@ "@*`ጒ@*`  *" <B"2"@f"㿀. * !<!* @`P* "PH/ "H*/ ! /  * ` * ///// @ ? ጔ  (" ,`" ( "0 `   ` ` * ጐ @ $ ,$$  ` = `*`  $  `< `* bH @  ` <"x<ǘ"( `  <"<ǚ"(  <"<ǐ"(#\  <"<ǐ"(#`  <"<ǐ"(#d <'2 c* @#h  2   . @* ጐ* (`"(  2 @* ጐ* ( @"(   @* ጐ* (@ "(* ጐ* @`P "P   @* ጐ* (@@"(  2 @* ጐ* (@"(  2 @* ጐ* (@"(  2 @* ጐ* (`"( 2 ?  @, ጡ, @&F ጒ@"`0@* ጑* 0`( "(;"㿀 <* *  ጑* @` ` ߔ  2`C?` ! >` `*` .` ,C4'''$H/`` #\<+#  @ܞ>ʶ4 ` `@P㿘<'# `P<(`  <<(b,i <ǐ" X  $<a 6    * *  * .  9$a  * !<B &$"  * <B`""  6  (*" ` *<!" ,  "*`$" ` * @*`@a*`$a<ƒbi  $㿐<'<B#  <b<m< ""H"@ %<E/<<'#c )<@ 3,`#@@ @(""Pd"P   9"@ "2`"k"02$"" "(̐@"@@~ <@! c `@ Ơ T     n`  "`,㿘<'#<  0a<" `2% * 2 xV   mj@"@`$@$` $ ?@& $&  <B ?,,,"ע`T_@Wy@Z؋@R@ּҔ444044444444㿘 ?# & `" $  @"  $@   å ~ &  $` @TB㿀  Ho`. * !<!* @`  `$ 2'?''$Ho` #\<"`)+` @  i$ ΐ  "K   <TQ<ȑ. * * @` P$"P<ǐ#ϒ  D?? @  <ǐ#  Ho` ȁ`0!?<Ȑ ?2<Ȑ X?  ? ?Ӓ  <Ȑ *?Ho` #' }`㿈* @*`<@*` /  ` *///// 㿈 <*` *  ጑*  /` * ////  /    㿘 <* *  ጑* @``## N 㿘#@2?   㿀%@  ?)`? //@  "  `< * *  ጑* @` g e  d <((("@ ((( "*` *` h B/ <* @*`ጒ@*`    *` @///////// c @B .` 㿘 kO  㿈`.`?#* "*  @̐ <* @ጓ*`@*`  />`  *`/// / ? h  @?`@ `/<" *` €, <a* *  C/ ȓ*`//////  . ., <a* *  C/ *` ///Ȗ  //// *`+  2<* *@ &2` ` ....ё*  ґ* Ӑ *  &, * +<a*  /@`   * ///̐" !  <q a/  N "*`////ɰ/ "? u " .@< "N `  .` ` .` `  @.` ` .`a/+``////G/"ɽ%, <a* *  /   * ///["  %  <Ȑ!Zɖ"0,`.`".`.`Ɋ.0 , <a* *  H/ *// ///  ?㿈 @p. <@!*`@*`  / `.* >>> /////퀧)$/)0)   / / X x / 㿈. <* * @`$  ?8a<Ȓ@`!P "`. * a* @` @   @ *`@a*` (/  >` `>`* >` //////i 㿘<( `  ȋ* . ?* <a* `)$ ?  `?Ȼ*㿘bb@"#\ba@"I\a bc@bh@".DX "b?D; 3< 2 a* @&0S@ !! `"H? *  -+2 <!*`" ; ;  < 2* a@ * &0*)?@ !! `2 ? ?f h͒  <* *  ጑* @`.͐@А@㿘. <* a*   2:$" J0 2<" J"0"0J2  2 K H@ ` HK " <ȑ. * a* @ "` <LJ88 L J`  L J` ` @ _<J"H"HL   L J@ ` L J@ ` @ @<J"X"XL   L J@ ` L J@ ` @ !<J"h"hL   L J@ ` L J@ ` @a 3* a* (` )"(+`J:`@` K J@ ` K J@ ` @8   . * a* @ "` 㿈. <* *  @`  h  " ,?@7 . @*`@*`ጒ /  `*  / /@$>` , , , ,   ጐ" "㿈 <,*`@*` (`  W Ƣ" P?   A   ,  } "Ò , @ސጐ C@/`  @* ///G   @ `*  4 ` <Ȑ"t  ` *  `  `*` ` * ު ܪ  @ጐ /@` *``//   Š `  <Ȑ"D  `2 `*` 3` *  *@ *  ` `*`@ *# 0*` +`+  " *"@ **    @gጐ /@` */ Ҙ ?<Ȑ"{  y `2` `* 3` `*  * * @ ` `* *`# 0* +`+ @ " *" *`* @ 2jԒ(P@ ጬ C/   @*`///   8 ` <Ȑ#//   ` * / ///j   ` ` *  `  `*` * * ጑* @` <Ȑ#8  * ጐ*  w"n" d ِ ጒ@`("`* ጐ* @``(  ' ś"ht(4@LXdp|p|<(4@XdLht L8L` O<|* <I#(<F#8<C#H<@#X<=#`<:#h<7#x<4#<1#<.#<+#<(#<%#<"#<#<#<!<#<#< <  <  (< 8< H<ɐ"؁㿘 "$ $  `  $ $  $ "2" I0Z 1 VHHo`$  $& & Ő $$ $$ `0/ -( *@$@$*@$@$0 $*@$( 7$ $㿐 .`  .` .` !#.`$. .`. .`!.`!, * @""`&!`82      &"!  @&!!!ؐ `2`2  `&!&!.` "`K*`<  € a.`,0E a.`, b. .`00? a . a a .`, b" 2 "  ?   * ``$" b. .`0" 2"  P&!Ȁ  `&!&! a .`, b  * ``$  b . .`0&!<T X` d'㿐o`   @.` .` ! `.` `/㿘"`*`<  €1<#81<#P1<#p1< #1<#1<#<#ȁ㿘   "  & " &@@  @& @L'L'P'T'X@vԔ㿈<''''c X<˒`<˒` ݐ<˒`(ِ"` < *` €<`8<`@< `P< `X<``<`p<˒`x<<˒`<˒` `$`< ȓ*` €<`<`< `< `<`<`<˒`<<˒`<˒`  !<!.@!z``$!<˒ar<˒an /<ː !*@;` <7<  b %<)<+<ˠ  " aP "aP aPIXE P` O@ P !x<˔!6 @a<˔!,` @ "@㿘`<B"Ā   2@2 `?2&@ 㿘`~`2``T&``l&`&` @ t&aa &`&`&` &` @ h` &`㿘`~`2   `Ta@ X`@ T `@("` "` "` "` `@`("`" `" `" 㿘"0   t@ J"(`a&"(&",<!` `A `@&!."V `C ". }  . } . }. } `C`E. & P P  ??( } a  #a#a  a  #a#a  !*@<T  P ?( ."Ta  #a#a  (P(O l ` Q S2"H0  2 "PP ? P(PP(O  P&!܀ 2 P2P2PH0 2 2P   ."5."6."V."4."7P  P0&!P  PP 2 H0` 2   ."5."V."4."6  !Д    ."5."6."7."8."V ."4  ."5."6."V."4."7."8P   P&!H1  PH0 2` " 2 `   P? ?( . } `C`E& . a  #a#a   } 2" `C 6 "`E ( `C " 2   P+P   O@2 . "  b  @ " t. +O. +"  b . +0 t"`  + +++8+<+  "@ ~&   ` x ` @0++@ >" @ `$ 2 x ` x `+ 㿘&  x&! \ &   E&! &!2&!"&! $"" $"a 2a"ab, bZ  㿘<,!ȁ?㿘 @!< A!!}! y㿘",< \"<"0  \ \< "`  `<`"` \ " << \"ː<˲""0< \"耤 ! ߐb㿘<ˢ x`#` `\b,  ,b4 ,bV,bX , :  "b( ?$b( "b,")@2!!"$! $!@  $ ! ꀤb,     $   $ 㿘",  $! @&","0 ""(# @$!"0` a&"0 "( ."Z 㿘 \<[#  ."Z .`  㿘 x   㿘", e&", @$!"( ",  0<2#@<-#P   "", " `  `?* `*  `$  *` ` (  *` +   `$2 *` "*`  *` , (W(Y!  %"!,  "",*`   !a #a#a  $2 ``@8  "?`*@8 ""! ; *@*`*`8*`<` 2 " " *` ` *` "`" "0*@; *` ` $ `2"  /"" *`  㿘", ! $   < \y#В  ."4."V  $` ` ` @&0     $` &  @ |& & &&  $?`  ?&& < \7#Ő"`  `@`* @!耢#  2 @`* @" @2,`! !"" ! !` ? 2 "  ""! !""   P`3 ! !0 0- P`)` `. ` ``   ! !  .`  ."5  ."V."6."4."7."8 .`  .`   .` !  ,$!$! 6#  \< ( \<! H \<  p ~  \< @   P "P `P ?"`P   "@ $ 쀢`$ < \ $ 2# \ ~ "  2    ?$ $ $  $    @,<j   E p``"   H02 `  㿘",a *a %%   +" `$, ` , `"  ,  (     $a  a < \V! "U ,"T`5,"V"0  D"  D.` ` `   `@!*@@ ``P  `P   ``P ?"`P`a `*` ! `2 \ D.` $a"0 $"0a 2a"a"(  $", <̐!@ 0 㿘 \<!p<!"(< \!  %<#< @a A! 2 @",< \!  #< @a A! 2 @"0< \!  #< @a A! 2 @{؁ 㿐" " `  ?"  `@ ?*@ @` `":` &    ?"  `  ` ? `&l "  .` "` `/2``Z .` "0 "0 !  @ 2 A 2 !"# 2 O8 P@2 P O@2 P"  b @  @ "&", P. .` O. .`"  b @ @. .`0&", .` "` @  P.` &!!  ,$!$!  㿘",a ,2%   *" `$, ` , `"  ,  (     $a   " \ .` "`G   $      @&  +    &  @ |$ & && t $?`  ?&& t `  t `0  t* t *` t $` t $aa,"Ua ,"D < \5" ` 2  t $`$a a  ,$a$a 9 2  \a 2  \a  +$a$a ɔ,<"0 ,"W,"Ya  %$a$a @K<̔"X ,"V,"X,"4a  ,$a$a  <"a  ,$a$a @㿘 .` "`  t *` ` *@.@.`#& `$ 2 x!& x?&.` ", * ""," 㿘",< \"!< "Ȣ "0` D" 2"4 D.` "4   <"  $$ H0<",PP,O ?$P  $$ 80 <~#  $$ -@ 㿘", & ""," @۔㿘", # ""," ^㿘", ( ""," @]㿘 < \#8G  㿘   <( aP* @0w㿘b,b  ` ,`b  `` ` $`x"@2 @"@ &` @ |$`&`&& ` $?`  ?&& `  b0 2$a<`\#$a$b,$! $!b( $b(a 2a"a^Q @ a* aܒ@$aP $P ``<!*` €<`\#X @ ! "?b 2.` b 2 `} P   `   .` `}  & C  E ,`}$` C"@,`!  ,$!$! A2I`\b0  D.` @ a*@@ ) ` "& b4 2" ! "$a!  $a`\< A#x @[ ,PP,O $P$b,! $!$! b($!$b(0t  *  <`\C#g b <6#`\<2 < `-"@  <'"P  <!"`  <"p  <"x  <"  @< " @ <" "<<"<ɦ"8<ͤ 0< `!<ɒ !```` `<<!!< !< !<!<!<ɒ!ː  <Ő!  <"  @<" @ <"( <"080 `<ɒ`"``` `2<<" "< "<"<#<ɒ# <˰"`\< 8`b@,``,``y,```<s"P``<m"```<g"p``<a"x`` <["` `@<U"`@`<O"`<J"H8F0 `C !     <<!!< !< !<!<!<ɒ!   <!  <"  @<" @ <"( <"080 `     2<<" "< "<"<#<ɒ# ސ"`\<ڐ H 㿘 "",   <͐ .` ", %    \ `", ,  "","! 㿘 "D`,"U \< ", ,  "","! 0S `  ` 2 ",", ,"W  $"", "! 0B , "","a "D`<!$*` € "D< \ . ",< \ @z 0% } ", C E, $ ", 0", 0", +"a  "T   ", `P*`O "`P*`P㿘P     ."6."V."4."5."7."8P  &P \<&!;!a  ,&a&a  㿘"H F"G*`沤 @sX"@sTb@,`"@*`" * *  $@sHc"  ", @ b @@<ͦ!(,` , 4<<!8!@ \< @!P<͒!h<̀a<!<ɔ! 0",< \! @㿘", "F  !"G  "H       ."V."5."6."7."8."4 $!Ԁ ",  ."6."V."4."5."7."8  ,"", "a 0뀤 !؀  "   !@sw#, @r?` " 145 ,`O!˒@,`P" `2# `P``  14 @" 2 @! `P*@,`P @ b @    b @  * *@ @ . .`0 `P. .` `O. .`"&! `P ,`P,`O. .`. .`" ```   @ b * * @ . .`0`P` $`P \<!!Д   ."5."V."6."7."8."4!  ,$!$! V !  ,$!$! P B "G "*@&! \<;"< \"0 4  @ b @   @< \"h $  @ b @  *@ @   . .`0!А   ."V."5."6."7."8."4`P  $`P&!< \"ê !  ,$!$! 㿘", a #!   %" `$, ` , `"  ,  (  n   $a  a *"A "D 7 "W    .` 2 "  `  .` &   ` `a  $$a$a "D "Y`"D "Y * "Y ,"Ya  ,$a$a V ) "W`% "Y `` "D 2  $,"W  a  $$a$a B( ","4 ,"V,"4 .` a  ,$a$a ,"W`  `,  .` a %  a +", )   "%   6 +   t*  # +  (` (@:(`(`8(`< (` " x@" ~"0 (`    + # (`(`  㿘"  &  @ |& & && .`  2", \<ퟐ"   , ""," Q *` V"#t  B"qt2 4*` 4  *`  *`2 ~ *`{  4(t 5* 2*` 4  *`  *`2 d  $x"  2o""g t  4*t 5(t 6* t 7( "*` 4  *`  *`2 4  $x"  2o""6   4*t 5(t 6* t 7(t 8* "*` 4  *`  *`2  *` 1, $x"  2o"" *@*` *` , *4 4*` *`  *`2  *` *V *` , 'a  "a, 㿘 "V (4 " . 0zR $ =& `$  &  @ |$ & && z7 $?`  ?&& .` 2/ \" 2.`  + 2" \<l" "V` .` ", &  "","! 0- " "6` 2 "6",  `P2 "6 .`  "6<K#   "6 2 "4 "8 "$! "4,"V",,"T  ,"","a 㿘",< \#H ) 㿘", 0! `  ` <(ap* @0ݒ0ڒ㿘   "  . `", $.  .  @ < \#p`< \#  < \#y  "` .  (  ` "0  `@` `@ \<#<齐 `@< \빐 H`L< \ `@뮐 ```P C"`P `ǀ ``<a v4 &< \뒐 +  \% < \눐 ! `< \! ``a @< \!`h  <(!#<ΐ?  ,  \Ta  ?㿘H`'<BĀ  " 2  "  "*  @ "@ 2"`2ā㿘H/``    "` @ "@    x( *@  7,7$777 75555|5t5lEE8EEEEEEEEEEEEEEEEEEEEEEEEEEE㿘<Φ@"   `   4` d@` ?? d@  2@<꫐"@ @ 2 ?`<͐ (*` €` 4``4``4``4``4`@4` @ 2@  2` d@ 4d@d@@  ? x' ? d@ 2 <q# #%? `  x   @"? 2 <Z#8 `#` ?w ? `  2@<E#h@ @ ?`<͐ *` €`6` `6``6``6``6``6@d@ 4d@` ?# @4`  㿈 x HH/ 4@r    4$4w! 4 4"4B c %%%% % w ` `2<#4@ %   4   4   4 4 4 `  ,%##",%4.$    ! 4%4% 4% 4%4%4%4%4%4%4%4%4% ͈       2@ 2@L% "2@ 2@ 2@2@2@` $ *@?%? ? @ *` $% 4@ 77  <$>#% 077  2$@" $<*#  !777$ $ 777  <$ (   777777w  " %$<ϐ X9 P  2%  777 _% 377W  ). 77O   $.  7 E% 177=   8@. *  7777.   ` % 77"  $  㿘% @ % @<$Ր!萌  % <$ː"% @ <$"H <$"h蹢`N%  2.%<$"订`.% 㿘 x`4 e2  <S \{<S#Ԁ`A<π`<D <芐"@<[a t€<ϒb@`d #Ԁ`e% 0`8<) 0 p"@<[a t€ 㿘 xd1<B`\!<а"@"@d`@d 㿘!?&!x# @2` @:@ `>! E`? &`$ ~ 2 l    +` *`  2  * "2@ 2    * ` 2?3  *@  ? ? *  㿈? x%2`@ @ <&!TbHH/ %?#2` @@&+<B %  8,77@* 7@` %"% @* 77 ` %? ? @$%c, ?%c %2  " < $a\",@㿘x  ,  ` & $<珐" &!  @@nѐ ,   ,`,` ,`  % 5$<% t" &! ,@  @@n ,`,@ @,` A,`  C4` 4`   P`@  @* @  `<a@"  @* a@"@ a 4`  @a@*`"  4`  E  * 2` `  @ 4`  4` C`@lؒ E ~ I$? @ 4` l`    ?  " " `8  @, ,@ ` * *  * * "     $  " " `4 @$`<"?$  T@a l& $`  T $`$4`$`, "  @ *`  " 5%  $ "@,*"  5n%h  &!@ 㿘 `& <͐ @*` € ab  d h@@2        < "戒  * >㿘H`1<B#,t  k  5$@ " @4 @  @@@ $5 "H$, *` "  ?* 2     "  $ @`̒ @k֔   r$a$a`~` @` `@ `T@` `@ * " 5 `@2$ 2#,㿘Ho`` j4@ "`@4 @  @@@ &`4 `"H&``, `*` "  ?* 2     "  &` @`̒ @kQ   d$a$a`~`d @` `@d `T@` `@` * " 4`@2`&``㿈< @# Ar x` 2`!耢  !  + @2  @  A* 3 7777  <@<H#H ` 2`㿈<Р`x<#p  2`7%7h  @" <&#   2`blbtb|bb|blbbblc8ecdf,hhdheDffglllll,,|}X{8{,,}z@~qyyyyyrxpxwuyyyyyyr(yyyyyyst<ttyrx@xyvyyyyyyvwdHtt|ttt l㿘<(@`  4"2`<"#Ȁ(? "?  %<(?Lh 2  < # @[,h  2  4 7& 4 2  4 ?& 4  2  4 ?& 4  2  4 ?& 4  2  4 ?& 4 2 $ ?$ $ 2 ( ?$ ( 2 , =$ , 2 0 >$ 0 2 < ;$ < 2`*@$`<( ?$`& 8` `$`@` 4* `:`*`  $`<("`<(@` 4* ` <(` ?`  $`<(" ` <(` ?`  $`<("$` ` ?`@  $` <(<ѐ t`$<(b( $`"b(㿘<( "2`<b H <('?"(    2 `?"`"( 8b" 8<ѐ p9$ <((`* ` 0 ```` 2``*0 ((?`` 2` 㿘<("` *< , ͑2  2`0?퀊  `4 * 2`$$?`$@   @€ @   $  <  В $F/4`㿀<("`< a'€b`<ѐ!Ⲓ O b 2<⨐!0  4* `b  b 2<◐!P€ b ?<⊐!x? ?<ₐ!?€? b <r!b s?<k" n?  <c"P "c?@R  b X?<P"xS? b  @b 2<<A"<`="@? <6"b 2</#0 €b`<ѐ#`#  b 2#<<#<  4* `b    €b`2b<#b <#<# `4*     €b`<Ґ 㿀#<(b <ڐ (  @"n `_%€b`<ѐ!ǒ Rb 2<ὐ!0  4* `  b 2`<ᬐ!P`€ b :?< X 3?< `€?  b $?<ѐ!?  ?<~ ?b 2<u"P@i 䀢 ? 㿘 *0<(b <Z  ?$    2 <Ґ!J $ 2 `4 <("`2  2`<7!H`€     ``$@2` `@  . 2 FѐS "HВ      4* ``€  h ȡ,  @ < ///<€㻐<("`2 8<!h 80@ ڒ  .` 2``  㻐<("` <!&  "h<("`2 8<ఐ! 80@`! Ȑ @+  /Ȁ`  / 80@ /Ѐ`*@.` & 8//`<€㻐<("`2<}!  4* `!0?Ӑ#@  `& ?%i " ` <("`##@ ?@"  `&  㿘  `*@   4@ * ` c€ "    $   `* @$ 㿘. 2 `   `4*@  ̒ 㿀<("`&@&`&`&` &`<" 4*@!2,Q&`c ?2G&` D&`  3/%</ ,c  •  ` &`2@`  &`  &@` &`b  8 ߵ $b  <` "``@ߥ`㿘@ $`2*`"  * ?@*`  *" & K@b. @b K  <@a. @b <..@㿘@f ,`@f& & *`  ** <҄d*   " * *`  * *       "  * H@f  @` ;<Ґ#*` €<("`2@<#"@ 2` ``<€ '0@2 * * <("`2@<"@ 2` ``<€  `O<("`2@<"@ 2` ``<€ `@d  <("`2@<א# @ 2` `g`` :`:`:`////`<€  ` 2*@ * 2 `*`+ 2  ** &` `@dS  <("`2@<ޠ#P@ 2`0 ``<€ @ * * @&@<("`2@<ރ#x@2` `*  /` @d `<€  ~.@<("`2@<f#@2` `   /` @d`<€  b.@ ^.@<("`2@<F#@ ?2`֒ `A`<<("` <6# Ȓ  @ez'`<€ 70@3 *@ *  *   *  &@.` .`<("`2< (  ` //`<€ "  0@< X? P`l?l @ ////`<€ Y,@,``@ @e@<* *@2 *@* <* *` 3 * + @ <*@ *  *   h  *    &*` 2 ? &@  * +`  0 *` + *  * @  ,@(@ $$$ $ ` В `2 @/////`<€  .`.`h(#Ò  ?ה(@ @   /////<€ ``@b($T㾨8 @  //'/`<€ 89*  `&`<Ӑ  ?`@b< h(#s  '?(@   ////<€  @ `*  h&`< ? `@b`#㿘@`!<<Ґ#*` €Ni ܵ ?㿘 @c`.`2` Z.@.`.`.` <€㿘@c ` @c ` U`2` .`.`.@.` <€㿘 @c̐`  .@.`.` <€H   B @//ʀ//ː /ː /`<€ Ԓ   .`.@ @ *  p@&@ .` .` .` .` .` .` .` .` 㿘@c  (>>>? ? .@.`.`.`.`.`.`@`.`&` <€㿘 @cc> / >>>>.@.`.`.`.`.`.`.`.`@`i$&`i0i   .`  .`  X x .`  <€㻀 *? `(a<Ӑ *` €<("`<Ӑ!(`4 ˰?D;  @iS    2? ِ /` € 2 D@i3    ?  <ۗ!P <("`2<ۍ!x  4* ? ~?<("`y`€ q`€ k<("`2<g!  4* `T`€ W<("`2<S!  4* `@<("`D?  ?$  ?`  $ <("`2<5!  4* " #2  ? 2.  <("`< "" " 2    4* `>   4* @? >  <("`2 <"8 > **  $ ձ> <("`2<ѐ"`  4* ``€<("`<ڽ"  4* `   (` ?`€ <ڞ"\@ !! `Y<("`2<څ"  4* bz?`(@u<("`2<Ӏ#<# <Ӓ#(i   4* `\? @ <(""2`\@ !! `2`D?`€>\@ !! `<(/?"` <Ӏ#0<#P<Ӓ#X$ @ $<("`2 <#` `4.<("`< #`4 @`$€ D; @g    ?  <# <("`2`4<#`4(ٰ?  4* `  `€c˰  `€c ?Ԓ<("`2<ٳ     i   d i  h  g  e<َ 0 <("`2 <ل p~ `4 * @?p? `[<Ґ#̓*` €  4* a^?D;  @f    2M? l /`, 2> /D@f     4* a ?D;  @f    2?`, 2D@f р ΐ   4* a?D;  @f|   2?  ۰?/`, 2Ұ 1D@fY     4* a<("`2D<ظ D; @f=    2?`,  4* a<("`2D<ؕ D; @f    ? {`,s  4* ag<("`2D<l D;  @e    "`,V?O  4* aC<("`2`,<H!`,( ;D; @eŔ    ,?*   4* a<("`2< !@< `,   4* d2`0?X@_K  ,@_Hȓ>`  ///''mȁȦ , @_3?`@ ` <Ӑ *` €#  @  8## @" )  D@")0D( D;  @eL    ?O*`" O*  * *O"@ @j i  p'ԲȘ   V  w rDԐ@e i fD;  @d    2?  O*`" O*  * *O"@ @j2?`4 .`* * "*   'D   0l, , $, Ԕ@d@"? @4Ȕ )0 .`0 D;  @d    8?? Đ / * /77TPDf@dx  <("`2D<ߐ D; x@de    ?x G//y|/}/z/{//<("`2D<ֹ!xD; p@d?    ٰ?p Et2 2 s2`u2 ///////8@ <("`2D<֊!D;  h@d    ? ''Ԑ  8 $8 @ `'ؐ  #@2H-2   /h  /i  /j /kDjd'Ԑ   f-2 @  h , @ i @ , @j ,@ k , 'K<("`<!#@`?  ///<("`<!#@`? K// <€" `4* o(U  <("`2D<ߐ" D;  @cd( ( ?0 D@cM( ( 2?Ӑ0 `4* 1<("`2D<զ"HD;  8@c*    İ?V D `4* <(?"`2D<u"hD;  Ȓ@b ,  , ?Ԁ@ `'ԀD@ D<"@  <Ԑ"I?0v@<A"n?     'b?@b <€  Ԑ@b؀D @b @  @ 2?,0<<("`'0<"ؑ, 02 @ؒ -D;   <("`',<#, ,2 @h D;   @bk    ? ?h. 2  O?#@2  R /////`<€  `/'`<€h. q2  $'  Q//'`<€ @  $'ؐ $'ې/`<€@. 6 J 4*@@ 6?@2Ȓ . ˦Ƒ*    ! @ ?, 2`     @`&@?" &@   // ,c耢   &@P. 6  4* @ )tЀ %,֑ۢ* @ ? ,@ ?*`2`1   ,  &@,2 q 2&@@  &@㿘<` !@`<' <Ԓc(@O<Ԓc`@O~<(b( @  +<'<Ԑ $@Orp  @<Ԑ@Ojcx"(  @'< @Oa  @<Ԑ@OYc"(  @'< @OP  @<Ԑ@OHc"( @'<`4 ㈔* @O;   @<Ԑ@O3c"( @'<`4 ㈔* 2@O%   @<Ԑ@Oc"( @'<`4 ㈔* 2@O   @<Ԑ@Oc"( @'<`4 ㈔* 2@N   @<Ր@N`"( @'<`4 ㈔* 2@N   @<Ր@Nے` "( @'<`4 ㈔* 2@N͔   @<Ր@NŒ`8"( @'<`4 ㈔* 2@N   @<Ր@N`H"( @'<`4 ㈔* 2@N   @<Ր@N``"( @'<`4 ㈔* 2@N   @<Ր@N`x"( @'<`4 ㈔* 2 @Nu   @<Ր@Nm`"( @'<`4 ㈔* 2@N_   @<Ր@NW`"( @'<`4 ㈔* 2@NI   @<Ր@NA`"( @'<`4 ㈔* 2@N3   @<Ր@N+`"( @'<`4 ㈔* 2@N   @`   `,*`*`I<((`V<(<(<(<( $ @`4* ``"`@`4*``"`@`4*` ``"```@"``` 㿘 `>:  $$?`.<Ӑ#*` €<!x$<(!""<!|<(""<!<(""<! <( "" <!<(""$_㿘%<)P  !<(#즒  <(` <B<(b<""0$`<(<(<(b<  $!$P"#"#"#"#"#$@@@@@ā㿘<)} ` ?`  ?<)<)?( ? <)<)??㿘HH/ <B @ <)#m<)`<!@@ $ `㿘 ``< "a)<<< "a )<Ȁ  <*!"Ȁ`)<<)!П@  D< <*!")<` `<).#<) @XA t@)< D<B<B"#*c!< D< `"$ D@ <B#<) `<c*  <#` c) "$`c<)<a+    `? `"<)   @ <)@ <)#  `  <)2` t(`<) ` @( *ै@_ $ <) "  <) ` <<)!@ഐ@ $ <)6  t(`  <)@( @_@ *<) \``` D<)aP @<B`V DS D  `@2J.`: @NG D  A`? D ` <)|@ 4 D<)<+  @@ *` #. 2       `*  2 <) ,  .` €:` * @ D % D㿘<) ` #<)`*T! <P "T*@L`"P* "L`04 @_!Ho` "0# 쁊`㿘<) `~ #<)` 5 N<  T!  P "T*@L`"P* "LN ` 04@^Ho``"0#`쁊`㿘<).`#` [ O*`* 㿘} <) `u <)H <) 0(dž* <)H <) 0(dž* 㿘<B# h㿘<)J `<) ` a$ z 0U 㿘<) ` P 0@<)H <) 0(dž* <<`D< "`D㿘<#'<%<c䀤 ?" > "?D$ $D㿘<#`'<%<c䀤 ?"  " D$ $D㿘<)`,T`P#T .L #P(#L`<!0!4 @]H` &!0" 쁈㿘Ӑ 㿘 㿘r <B<B <)*#*<D <)<) "D"`㿘!<! <!   2$!㿘<)%`㿘@7㿘.``  `<) *` €㿘<`!㿘.``3<)`  <)@( < D@ <)# D"<)` .`"`9 㿘.`` <)#  <) 2**' 㿘<)  *   <."@ <-#@  @  ` `  *``<`D < "`D㿘.``  <,#@*` 㿘.``L<) `<) h` `<)#, J A 0:` ` ) &. <! €           @ 0  0` G 2` `0<)#(J@ ` ` 㿘.`` <)<)  c0 J 2` `㿘<)<)J  `A  *.`  <)  `**  <) `h   +<) h   *  `h `` *@#` **@#` ` 1<) ?< ?& 㿘<)<)h  (  ((<)t . ) <)<)<)`h.  t<  >`(`.`6 `82 ? " @)/@?>`"` Ӆ. 㿘.``<) `    0 㿘.```  ? 1<) ?`@Q]` & *`` <)H<)਄  ( *<)42 <B( ?@?* <D D<* `*`<B#Ą (  "  `?"`+  ?+ 㿘<<!*`@ ` `@2 <B, #˜ ``( <B c` 6 `@   `` 6 `` @ " `  ``@ "  *  2<) `2<) c5 @ !<)<)*#4!*c5€ !П@㿘<)!П@ 㿘HHo`<)#8V <)!П@ ` <!@@$ 0!П@ `㿘<Ca`  ? u#"@<C!쀣 <\"@"@6 <B `* `"  2  # a# <C! "<CY <C! !㿐<C!<Ca 'P' $@?0wv?<CaH`a "'"a!쀢@  !!!쀢@ !H` `2"`@@+!쀢@&<B#%;D *`@@X    a $a쀢`  ?"@$!耢 &㿘<C  㿘<C!`"<C[<C!<Ca쀢 A 㿈 Z#@ @"8D Z#@"@"A<CQ<֐ @@8<0H @"'D  (@" D)@<07@O @*<00D; )< !&, ;   &$ ; ?` ?D;  < !& D;  ?`<#<)`" <)" <#<`!*  ` `?@*D; ? ``"<!` ` ?0ڰ?ꀤ` <)!а @0<!  € ˰   € Ű D; ?`2 `2 `2 <#4`<)< *!"`  D; <<!*`@ ` `@2 <B- #˜ ``( <B c` 6 `@   `` 6 `` @ " ` 6  ``@ "  `* ` `2<) `2.X <)<)` `/@M< d//D; @W    =?; ; D  ? 1? @Wx 逢`2&?ꀢ`<)" @M  d<)"`<)" a<CD;!쀢  "  " &  ?Đ"0? <)L<JaԆ  L<<C<C"!*a  㿘<)cL? "cL<) <a*  ?*<*!"?D  <C(`, *`@ "`0 "`4"`8 "`<"(<C,(`?<C,0 *  , 㿘<C! ( , '  0* $ ( $ `$  W   !㿘<."Dd )`i`""@2$ !"D@iD㿘`<."H`1<."L   &"L&bH3<.bH <."L `""L<."D<#&bH 㿈 8ߐѐ ̲ <Ca Ƣ  E2  *  ` " .    <0A"/  E<0: 8 `**. : `*": `*" . : @ "?&?a a `" *`. : @ " &?a a" * Ȥ#8a Ek*`a  2   8 ?* 1: /N -N 0Z @'. # `7'쀊 #" `7'쀊" <\ #! `7'<\"@"@` @ '''ؐa  <\b@b@#7'''ǐ@$  <\b@b@#7'''@`   $`$  V   !<C    (    ?㿘<Cϖ  㿘? <Ca`? "`"` ?㿐'' D$@?<CbH`b "'"b !V`  !H` `2"`<C a` .@!;  7@U0    ! & 8D&a`?"`<\b@@"0>?򀦠   0; D@ ,.@,`  '?",  ; D@ : .@ ` $Da`?"`<\"@"0㿘<C"`"<CW<C" ` A 㿘 8? ?00   #?0&D;<C& D; D` ?<C  ( ,?? <C  㿘<<֐#cЁ㿘<<֐#c 㿘<."  ?  2㿘<."@㿘<."?㿘<<א#Ƴ`㿘<<א#ƫ` 㿘<<א#ƣ`0 㿘<<א#ƛ`@?㿘<<א#Ɠ`P?㿘<."  ?  2㿘<."@㿘<."€㿘<.b 㿘<."Ē€㿘<."ȟ@<."  "x<!<פ``<<צ pɒ` b a*`,,<@Ec8<@F`  <א@G 2 <ט  ? /0'@Mo @Fe @Gx @M` ؒ@FV <א@>z`@Ge  @MM ؒ@FC <א@>g`  @?@>m ,  @? @>d ,  @>_ ,   @?z@>V ,i`"4, a,"/,bX`!,)d,#!@, "@",#@%"@ ,  ,,,,,"` - `0` `0- :  n" o e0"ca"`@& $<."  "㿘)HH/  `` ``*` ,S ,S  㿘)HHo`   ` `* ,Rސ ,Rې  㿘<."`<$!o<cx €0@A㿘<."Ф  @ `,R R  `` r``D  `  `R N` % <) X" X"`#<)`X `X$`X $  M     0$  , N`   $ N`  <) `i #N`   3T!*P $T*@L`$P* $L`  @RH ` ,@R@ @R=  p "` g` `\ `D` @ 0`_'R)  @ )?0%` `" `a$ 6`` (` @` &` @` 'R   @ ?,`Q `` /&``#&``h` &`h<.` @Sz<Ho`&`"`<`D "`D`  (```+ "`` `D ,Q  Q ` p ` `Q`"`aT!ca0  O$aTaPP `@ `D `  `Q N` ) <) X" X"`#<)`X `X$`X$  M      $ P$`X$  0 N`   ( N`  <)ܐ `b #N`  m䬀*T!!P $T*@L`$P* $L`  @Q? ` ,@Q7 @Q4  p "`0<4 @RHo`$0"쁊`0l`@`\ `D` @  `_'Q  @ ?,`P &`\` `" `a$ 6`` (` @` &` @` 'P  @ ?,`P֐ `` /&``#&``h` &`h<.` @RQ<Ho`&`"`<`D "`D`  (u`2`@ ` @P` *@P  oN` "N` N` e ْ 0a  ,@P @P  Q @` `D,Px  Pt ` p ` `Pm`"7`aT!a0  $aTaP*  aP*@` $aP @a0aP* $aPa0<a4 @Q֞2`Ho`$a0"쁊`` 0*@P1 0@bЀx@㿘<.b H/`b"b     €"` 2 㿘 D  h @Q!  )h `@)h !)p !㿘 D 㿘<1!@>l㿐 < &    @Lx & ?HHo`   /O   /O   /O 0  & T*@O   8*O HH/     . ,@O ,@O        ! h`  . !. . . ,@Oo ,@Ol    ,@Of,@Oc    ! ,O\,OY   *@OT *OP  D`a @P& & @5&  <  & < 㿘 < #HH/  " D &  D`a @P < *@& < 㿐 D  ! 4 `  ? # "   < 0 "  0" X "<. 0@Di   @ P. ,*& . +. ##*  HH/     }. ,@N ,@N 0V @ P. ,. + . #& @D2?: . %. &. $HH/     . ,@N ,@N  0 "          ? ` ?  ? `  `@   ? ` @`   ``. . .  @ .   .     .     .     NF d`c4   -@N> @N;   -@N5 -@N2  -@N.  0-@N*  `/N&  ` /N! ` /NHHo`N    -@N   -@N 0-@N  @-@M M   -@M -@M    -@M -@M    -@M -@M   -@Mݐ -@Mڐ   -@MՐ -@MҐ   -@M͐ -@Mʐ   -@MŐ -@M   -@M -@M    -@M -@M   -@M-@M     -@M-@M   -@M-@M   -@M-@M   -@M -@M  -@M -@M  -@M{ 0-@Mw   -@Mr -@Mo   -@Mj-@Mg 㿘<!`!HHo` @  'MJ  @ ?,`M@ 㿘<!`!HHo` @  'M#  @ ?,`M 㿘<!M   , 㿘<!`L   . > 㿘)HHo` <0!$@8 4   ,,@LՐ ,@LҐ    ,,@Lʐ ,@Lǐ  @ $ @` 'L  @ ?,`L  o?$$㿘)   H/)D/<./ @NzD<E;'<. @Ld%@% @4@4  @Dn @MҞ^ @D_ /@$$&H/ % %@44 `Ho` 80!$@4   ,,@L# ,@L     ,,@L ,@L  @ $ @` 'L  @ ?,`K  o?$$)/`, )㿘)Ho`" " " H*o`)hђ !)pΒ !!  `@㿘! ) "\H/    *,@K ,@K H*/ 㿘!  )\ " "\"\H/    *,@Kw ,@Kt H*/ X` <&?@E X; @' p' 4' 8' <' 0' b' d77D@ @K, <  < ? P`"]?D;@ @K <  < L?@C%!\@ !! ` 0@27? @@22? `@2-? < {ϐ ;π d0$?А& <& X !4 t?ꀢ $& 0? < /В p@& <& X& @& `6 d 㿘H/    @JH*o`D;@ ? `&@ 㿘H/    @JH*/  *``  `2 @`2!`  D;@ ?&@ 㿘D; O?  l@ "`8 m k@`A?ꀦ@" <?`  .  `  .    . ` ?} `".  H/     ,J>,J; H*/  㿘 4 + !Ho`     ,@J,@J    ,J ,J  H*/ 㿘?#@ )S@T@U@ X@ ! ? @0%@: @o@q=0X@vY@n=0 e@"DD md@0j@K=0s@pk@ m0G 2h!R b u ]  2X!B .*  bJ D; :D?! 4` `&= ; 6?!`  7& (& '##D; @I4! ! ? =㿘!`  ), `  ! @ !$*@&!$1㿐)HH/  9 ! 2 tt`<b"`$tt?$t<pX"$tt < $<!$$$ $$$$$ $<@")!$$$ $$$$$ $) &)d?#@"  i   ,,@H ,@H    ,,@H ,@H   /H  /H  /H_ `" ؟@ ؀`")@)*@&)<b $h$D  @"x Ԁ`"@ @@r @!*` Ѐ`"x@x " <`  !`` !<*@$<Y !㿘)L  b <*@$ < $ h$ t$ D? !㿐<''  /< ?>V  2!`$2?! @2<|l@2?<" @@d@?@! װ?Ґ"!( h2  Ho` "'&`H/  t?&tH*/ x  &xH/ <@HH/   .,@G ,@G H*/ ! <  />-?H/  ,Gn Gk  `H*/ <@2  ` 2>&\!H` `2"`W 2xt &tx ?&x< &< 㿘!V @ <.bБ* @6u?  <,`a* L `" Df?퀢  <  pX"[? t`$ t&)"$ D 2Q " tH 2<. < .<.V  2  !" " " "  " " " " !" " " "  " " " " " <.#T$" lR"2l!"`"$l $ |d$ 㿘<ג @1s#  @1o<ג#(,@ ,@㿘'<# @<$ . @<  ? ,F  ,F|<`᠒ # ,Fu,Fr 㿘  2'ЧHH/   @  'FZ  @ ?,`FQ  FM   ,FH FE `㿘V "<*` *  N@ 2N@ N@  `㿘<)z `  " @$* 2 B@/@㿘  `1?D';  )?`  ?  &@?@?@   D @ @E @A?㿘 `!8?   &@0?@?[ @; " ` D    ? *` " @ *  /$D "@0@?0?㿘  D; @Ee  ? # `X?c ?c cdc2co c(c!?A<Ic0Аc <ScW&<Ic񀦀"9?c<I'#c򀦀 <IHo`!?#@7Q``  Ho`#`@7Q`@< `*@"Ho`? @7``@>ې  @$ @< `*@"!?#@> <I#    `##` "#<؀a<!<ؒ!?# Ho`?#<I`@8I` }?{?ꀤv?#`Ho`#   # @6l@6B`?&  "  "@. Ho`!?#@7e `& " "@!@>64(?!?#@. "@# ` "#<d"?# ` "#<ؐ"0W??co 㿘 " " @5  @6  㿘`<#8 <I#     ؒ 2&`  㿘`  `?D; @C   ,&?00c`Xc0#! #"DX<I0ccx<IO#D;  @Cb    2H? A䰒 <H/`@5 쀦@` 'ð?@C1  `   '?0H/`@5 *@@C   D  @C0D;  @B    2԰?  4䰒 H/`@6'  " '@< $'  D  D?򰒠5   ?򰒠-@B  '@B"; @B    2}?ɒ v䰒 q찒  0gH/`@6O 쀦@P? 0ID; <I/c/ D; @BI    /?H/`0#@4^'@44' @B&  ?" 0 # ` "#<ؐ"`?㿘 `X O"8` 27<I^#2`7  #"H`  L򀦀/#0# "5` 0< :<I*`#%<I3#` <I#` <I#  ` #? W` 0 ?<I# ` "#<ؐ" ???㿘 h  <#8 ""&`X?㿘`X  <@HH @* `0((@" 0(("  `?0((@"  " `?0((@"  0(("  2`*` ("  * 㿘<!@HH/  `, , @6*  @5  @, ,  @6*  @5ߐ  @, ,  @6*  @5ϐ  ?@, ,  @6y*  @5  @, ,  @6i*  @5  ?@, ,  @6Y* @5  , ,  8P@6I*  @5 @@, ,??x   ?08D; @@    '?% \@ !! `2D?; ؒ@@_    ?6 <.Ѐ?  А <. Ё 㿘  @Y <!@</4`""4 %" 㿘</!<؀cP</H <!@</ <I `4 H##ܔ"`#`4 "` "`㿘<"J<,c(*@ , <"ؠ#<cH, D$t!@8`"`"`#`#@``  ``?@G$@H&!H`"$H㿘<* , , cH @ ܐ</ $ $ ܁㿘. * <cH* `@ @  2!  *@"2!*@!2!  *@"2!*㿈'D. <*  * cH <܀!'H'L' ' ,`2'L <'L<cD4$,$ (#</b<I#Ā` N  $#<I$b "##Ā` <I"#$##Ā<I<I<I"#"c"<I"#< (  D"  @2   "    >@ = >4%ԑ, `$* * H 4444$ $ "'D2 2J`L "@א`L 2 @ 44<$ $`2 <ؒ b#h</$   26ʀ`"@6*  2`" @6  2  `" @6*  2   @       ?# @ 4 2 @4`L` '@4> O!<I$#@5` `@5##@5* %`&@   " 6 1 @5k* N  )'@5^* 2 ?`&?/`2@??` %-.@6h- @#/`.`% # "@  ` @@6O$  `0  ` @5%`0`@%`@5` 2 `&`2 H`"%`%` @4^$@5@ @5;@57:?$ `@ * }@b%`#(쀣!5`"5`$    `!b5`$*5`"  !,,4</@2 <#8@` * ? H$쀣 D$`D`"a㩖 @@<!$*`   D⌒  !<I@4` `@#@4{* @5#`0  ` @4p%`0`@%`L`<I#</?"`$%`4<D!<I#Ā </b@3`  ` @4P#<I@"<I"#Ё㿘<*` *  * H  Ѐ` <#Ԁ`XU S ꀦ@ 4 @@6  耦 4  @6 </</" ,"`(  T!" @ $!@? @  Ԁ #"  T!@ @  Ԕ"  &*: @  Ԕ"  </ "`,㿘<*@ *`@ *`#H@И <#Ԁ`(<*!$  耢 2 Pꀢ2P</</" ,"`( P Ԗ"  @ </ "`,㿘<*@ *`@ *`#H@К <#Ԁ`-<*!$ %ꀢ2P耣@ 4 P@@6P</</" ,"`( P Ԙ#   </ "`,㿘<* @*`@*`H 0`@ <I#؀` @ @*    <I#؀`" @   ,` .T!2   *2`4 耣@ 4 #@  0H  ,@'</ ꀢ </`0@ `?7</ (`$0 T! @ Ԁ  "   .`4  4 ``(0(0$(   T! @ Ԁ  "   </$0"`,㿘</ 0`*</ , %? "$ ,<#<*` *  * H ``" </R@ " @ </(<Icܐ "($ ,㿘<I#<Ic̺     @2<Iؤ cȒ"@#"<I#Ѐ <I#Ā  <IcԐ"  ,"  ccЀ & #"  @1cВ"@$c̀ <I#Ԁ <IcĐ"  c  cc̀   $cȀsc̴ %c ??j?# ?   @ Va& `:` `Ԙ#  ,`2   & Va`:` `Ԙ#   ɦ & Va`:` `Ԙ#  <I#Ԁ <I#c̀ " @  <I#Ā " ?2 㿘 @1 /`@a ?# @  @ @@ Va$@ `:` `Ԙ#  -`2  `@ $@ Va`:` `Ԙ#  5 Ȩ  `Va$ `:` `Ԙ#  `$ * $%2 㿐@'T<#ؐ`aT"@* ' ܒ` @1e 'T`*@@ \*`T @ @?c @  Ԡ&@  <  `- 2  2@ &@   < @ ̲@  $@   : 㿐<-* * H  Г2``  `<#Ԁ`2m i<!$- 2c  "[ Y  8<I#Ѐ`. @0֐ @"+<I;<I'<I c@1 #̶ cԐ $#$###Ѐ@ `@ %#%#Ѐ`2 c<I"#</`$ 6& ` ``"o `&  Ԛ& #\ @#@  Ԑ`"& &* @"2`@ =`  #\  @ *:`@4"4$@0dT$$`|</P</`L "P"P </" T@& #\#@  @ @& #\@ @ & u T"@ *` b&  Z* 2 #@U@`  #\  @ 4 * : "@    #\   " "@4$@/T$ $`|`  </P</`L "P"P </" T@& #\#@  @D @& ##\@ @6 &  $@/̒T& Ԕ"    @/ @/ 2 ?? &4??    `&``"PT `& Ԛ& #@#\  @ Ԑ`  հ +` &"@2 @#@  #\#@  "@@Ř "*`44$@/@T$$`|U</@{& i ' " @^&  V+` 2 #@Q@@  #\#@  "@@ "* `4Ԑ #\    "    " @4$@.T$ $`|`  </`P" "`P"`P</`" T #\   @H@& ##\ @@:  w 0  $@. ̒T@ Ԕ"    @. @. 2 ?? &4??   㿐<*` *  * H  Ѐ`\<#Ԁ`7`4`2 @ @@   耦 4 @ 4T!@6T! 耧 4 T!@6T! T!#\ "@ #`@㿐`@ \@ $@'@-*$@#\#`'@#\#`@ۘ0&'@@#\#`#\#`Ț0V! @@ 6"@  6"  Ԕ#\ 㿘<,@*`@#H*`@%<IЀ ! </b-<I@-8 ؀ 1<I@1<I#<I<I"c"$Ѐ` % @-Ȑ#<I@"$</ $`<#ȓ*` <I4 ?8@""4?$`$! 4!   $  </ </ "@ "L </ *`" "L"L" L</</" P`"`T`x€   <!$, `$ `$? '< @i$`$  4@-h  8"@@-b2  ؎㿘<* @*`@*`H@ `X  ܀`   Ѐ 2J``"K  2 & "C  @-5 @-3 2 @/?8 ! 6 &T!  " @  "   T! @  Ԕ" $@  6 & Ԕ"`  6 &€ 㿘! "&! `" &!? " {?&!& 㿘. * <* cH `Ԩ $`  ` K?@ G^C?`a  <I#؀`@  a"a a 2`!$`$a &`4a4a`$ 625`2`$``"" a`"2 2`" a a?`,a,a4a "` 2  ?" @ 2  ` 2 &?" @ 2  ` 2C+ ``$ ?=!2`$``"" a`"* 2`" a! a` `,a,a4a 2  ?"# " @ *  ` @2 "  &?# @ *  ` *+ ?" @3 &m y` 4a$`@+v$`$``@,X `` @,R`@,N:a `?$`a 26``ʀ`"`@,>a*  2`a`" `@,4` 2`a  `"a @,)a*  2 a a`` @  a a    ?# @ 4a `@+(@@+$˖ a@2 !<I#Ā - </b@+`  ` @+#<I@"<I"#`a  <!$.   `   ٔ   ?? %?? x@ s   ư?0`` `?`!b?ꀥ4,,@+`B   ϐ??D@$?`$?$?` @ @,f``@   ?<#H$?  `"`@`"`2`2 `2 ` @1 ``>! - * <* cH  &`!&` !`" &` @  @,@-$``@  [ - * <`* cH  @D;  ? @1  6/;?@ؖ 24?&` &` ) - * <` cH*   ? , * * `    &`&` 㿘<(@*`@ *`#H @`Ѐ  <I<#Ԁ`<I2?#<J<J`    </ @ * *`1   * 0@  * 3 `` * XX "``X X0` 㿘<# 2 #<Ic؀ 2  @)c؀   @*# &<I#<Ic԰ <IcĐ" 㿘@ <@&@ 4 @*H@)^<c <I#ؖ #* 3@<#@ 2+<I#؀`%<I#1<I@ &@ <I##Ԓ"@ @ 4`@*@)2#Ԡ$, @ <I#<I#̀ "  2&2&0"82$@@ 00 * 2@`<IԀ@<I<I<Ì@"2㿘<#<I- * <Б* cH b 2 <!$-  2 `</ $`C<#ȓ*` <I4@ 8@""4 $/? !<Ic@)L  c@ #Ѐ/<I-<IĀ" $ $@ @*Xc Ѐ&  @))cV?' $Ò o \ </ L`</U? T"`" T$ T</ P@4$ T T "D Ѐ <#Ԁ`2; <!$-  23 `/  T@  T "@  !  >" $  6"  @($$`|€ T`2 a  㿘<I#؀<#Ԁ`*  㿘   00@)0D; @10  D;@ @1㿘 >.`  "  "    "   "& & & & & `&& B  & <  & 6   &  .  &  ?& && @@  㿘@ @ "@" ` " "@ 8 %*`* , @r`  @k` @d  ``@X㿈 'H   O?  @I5;@ ; H   44%4@`"4D; D 4  @ 4 @  4@  :`4 `  `@  㿘     T?  @:O ` @4 2D; D  *` *` @ 2 *` *` @ @ 2 @*` *`  2   *`*`2   ` ƀ   `@ `   </ ! </!</!</!</</</  @ @ 8@ 82@ 2@ 82@ `</</</  @ @ 8@ 82@ 2@ 82@ `</ </</,  @ @ 8@ 82@ 2@ 82@ `</<</</\|  @ @ 8@ 82@ 2@ 82@ `\]<^a|^^t_Da|a|a|a|a|a|a|a|_`aT H 2? R 2 ! ?㿘<#(  %< )2@Β@ o$&@@ $@P < c( +2 * @`0`D .?Ā  ! :  8"@ `D;D@ @  @/i2?@B >P < c( +2 * @ 0 D 3?vĀ@  &?:   "@?䀦 D;D@ @ @/%& @B >?򀦠㿘T &T>`T ?&T<#H<b ܠ @ "  L2 `  >a 㿐<'D"J@j'<c(.`@+ @ 0€ [  0 €. , <,  $%<<Hb*@a!aaa@&D<% $#4a4a4a4a&$t 2t t&tt`H@DH'aH`"&H H<<"`$  `J 2' H>?"' H㿈<ْ`@õ㾐 +<2  c(,@ 0`?C?"`3<"*` €@`  2.D; @.A    ?D;  @@..   2 ? @  K``2D@.    ? /` 2ܰD; @- D  DD; @-    2?` D; @-ǔ    2?` D;  @@-   2?Ӑ` 2D@-   r?pD;  @-    _??`>I<"J 'D@-k . + D; @-^    <? ?'􀢠$(*`Ԑ *` ?W !  Q``>  ?€  V` 㾰 < c( +2 * @ 0` ?`$?㿘 +<2 *c(   ? 0@€ 㿘 +<2`(*`   0 㿘</!<C?#( #!`)<J +</ ``,``2`a,` 6 (,` @ c( "@ <" L2  0@€   >$L @ "@bL  </</"</</" %bLC p  )<0 H   >$H<(*` </"  ??  @2  ̀" " " 㿘 \@#Y! .- / @#L@#H@#D @$@0C./ - !@@#1 @#+!@#&?(@$0@# @#"!$@# ? @$&$㿘a`@"@"@"`.@ @a &:   /`@2@"ے.` >`@% ?0  ?.`>`@%z ?㿘a`@"@"`/ @a@ @"aa> >  `.+   `.+    ??</"P ?2 * ? @@ & *  @@ &㿘`@"a@"/`aa: :  `*`/ @  `*`/ @  @)aa@"a `??@</"P ?2 * ? @@" *  @@"ۺ 㿘! @"9@"7 .`@??@Ö#?@  ""?㿘 * ` @"a  &a:   2`@"`` `` ,< @$ ?``@!` @ ?,< @$ @? ̀2"  0" " 㿘!\  !@!ΐ@!̒ @!@!ǐ@!Œ @!@!@!@"0I4$!!@!@!  !@!@!  !@!?0@" 0$@@! ?@! @!@!?@!? @"x $&㿘 "  &`Ҁ` ((a@!``@!]`@@@,   @!P@!N@#?0 @!G@!E@$0, @!=2`?? ?@#`@#`??㿘a@!#@!!``a@! ``Ҙ`(? `` ` 2  28 .`㿘a@ @ ``@`Ҧ @h )aa@ ِ `?@?  @`   2 `28 /`??ـ㿘!@ @   ?@? @ ?8* ? 㿘 "  &`Ҁ` (( a@ `@Va` 6" @ `@ `  @@ {@#*?0@ s@#5<ف p㿘 `"&  P & &   Pc  㿘<JR`@ R <JR`</ *@R0*@ @  <ِ@g`0+@<@^`0"<ٕ*`@T20**<ِ`Е2@K20@ 2*<ِ`<ِ`2@<㿘<JR !<J @  T @*<ْ``@(</@T Rc0) <ِ`<`<ٕ*` 2**<ِ`22@@<ِ`*<ِ`2@@&@㿘 ` = & </</R0R2 `& & !!@@`? "`<J&!` "` `@/`</R#0 ` </S#2  @ S#2 Ή 㿘<J``? "`! &! 㿘</R#0??5)<<٤!H!@+<2   !@* `* `* `* `* < !H* * * * *"`  `@&??2&㾘<#Ԡ@` ͐</Rc0 SN" ?@ <J@/ @R `'<JT h<ِ`@) 45 h<@aP@<ِa`@< !h,!h ,  ,  ,  ,  <ِa`@  `5 ƒ$<ِ @ 0^? h h< !@!@, ,  ,  ,  ,  <JR @'<JT <ِ`@Ԗ 45 #<ٶ$`` @`,`   5 `<`ap@ `5 ` < HH, ,  ,  ,  g$`@] 㿐<#Ԗ`73 㾘<#Ԡ`W</Rc0 SRc0` </Rc2 2Rc2< a8a8, `,  `,  `,  `,  `,  `,  "$<b Rc2@ @<<ٔ`a@J$<N a@=`'<5<<ٔ! !, ,  ,  ,  ,  $ Rc0 @1@<ٖ`@`'<<<ٔ! !, ,  ,  ,  ,   ᠖, ,  ,  ,  $@ 0+`@'<%<ِ@ ` ,? $@  @@$@ 㾐<#Ԡ\`E;@<`2:<ـ  <JR <JR`#\<ِ'a`  <JR <JR`#\<ِ&a` @M$<ِ @B 0<@>!؁x؀`-``0&%<JP ,@<JS` 0@$ .< 2* + ::03``@O$<ِ @  ?㿘`<  <ِ  @  㾐<#Ԓ '@'_</0</Rc2 2  <ٖ`\b@@ <٠a@ `$@ '@ 9< '<ٲ&g@!<ٴ!$ !***** "`'  @' ᠐* * * * '"' Rc2 2  <ٖ`b @<J<J2  2'v<ٔ"'@i 0E@x <٠a@`@@'@  9<ٴ %<ٶ& ***** "`'  @?'@ $ٔ0"' @$  ``   㿘</#  @  `  ?</  +` a    @ 2耢`  +``" '@ '0  ??"'<*'0*'1"'@ 㿘`"#'@'<<!$*` *'1 <'<*` 'D*  * H &'D@ '`".'0@.'0?&'@ 㿘 @` 6"@ 㿘 ,/" z?   6@5 'X`  ,  @    ` @$p Ő'X@`'\  08$'`^ 4@̀@ 6'1`27  H  '@  ".'1+  * <cH * `@2'|'D< &'D&'<+ $ <* c@  €   ?'|`"  '2 2 @ x g`"g@g "-`77`Ґ7g:77g:7g6 7`7g6`Қ#@7g:7`7`7g67g:`֚#@7g6`҄ 7`7g0j @g8`@` ;`g4 , : $:   : :$ ?@g4"` `: $ @v?g4`Д`2 `:* `."`?@e?@0$g4! $>@ $ `@Xg4!">@  `@O$ g4`Х*`` " `!>@ `@A?@㿘 'd`@U 㿘@ D 㿘@  `  T*` ( <(HD2! @2?` 2?` 2?`  2 ?` 2?`` `?  2? ? PD;   Ȓ@#/ ,  , ʰ?WȀ c * c * : : : 8Ԁ ?؀ ?D @ @#    ?D @ @"    ?D @ @"    ?`gp ^c6c$@6c D @@"” ^?쀤 eD @@" WL?`  @ " Vc? )*@+`  @"  " gl" Vc? *@+`  " @#? "gl@  .b 6b6c 6c6cgh@ 㿘'h" "`€."<!@','@ ;&' 㿘`  ``" b0M" b0J b gh,b€,b0B ) 4c! c4c,b$4c4c@!?*`$ !e?* #!<4*$ !`x?* #gp  gl@g6.  ,b4b!`. g: 4c!@g:@4cgh@㿘H <& .<&ܔ <* cH* @  @?    |* @?  㿘 .* <* cH D  <J  *@  $<J <& t .@*`@<#H*`@`@0 E`? 㿘 "@ "zg@ "@ "^gh"@"Dg"@!"@".Dg@ "gt "@m@"gtg "@L "@"?DgD; b@!?    | z?!;  ? qgH&&b@!'  2g?& b&$?&(DgHH H ߑ.@"P ;  ? GE?ꀣ  <`H@!$*` 9 D; 3?`g2 , g|`(  g0 ""/g2g1 "/g2@/g2  gx`@  /g2;  ?g2& D;D  ? 8? !!"     ? 2ܰ? @   ? 2԰?   ? 2̰?  6.b  ( +@ +`    ?D;D  ? 8? !!"     ? 2? @   ? 2?   ? x? 6gt* & b* @b@*  b@* ` `gt Z W?D;  ? M?c 6c 6G gh C?g@  <`H@!$*` 6 /b0gh ,?g@ " D`H<@!$*` D; b@Ҕ    ?gh@   㿘<J *` <*  H*  @    <& `H . * * *` @* *`@!a b .b* H*     "@ g" 2  2`@gD  g4g8 * H*  &g4&g8- % @O  㿘 'x` @ '|`@b  *  @  ( @b@* !b@ `* "#b *  2`(b2(b2( 㿘<J .. <*  cH* @   <&K gt  * <& ?gt  *`@cH*`@ !㿘     <3# ` <3# 6  <3c c  2 2   ,``  @ ,@%2 @:` ,`@$2 @:`@ ,,`%$ &&  "'  ,"'42$'8'8$'8$'4H  㿘<!#<<a$#Ȣ )<  '< #H`Ԁ "#`2```H "`2`g "€  ` `"` 0€` `>פ " " 㿘`ԧH``  "  &a: $a "  &a: $a?:?$a#$a$`$`$a a "a/ .@@8.$i4/` $i8$i4  $i`  "ԉH/``? a:#a a:?:#a#a#a#` #`#a  #i#i #i  #i`  㿘`ԧH`a . a8@  * a@8a@ 4/  `a `> $aa> `$a: ?$` 0$a?$a$`$` $a $`А $`$` $`$`a   * $`a  㿘`bԱH/` a: ?: %!a0?:@ `%!% %!%!% %  %! a/`g4 g8(a@% А % %  % % aa ` *+**a@ @ @ @aa@ ` @@ @@ܒ @@֒,    @*@ *  @@*` % a ```% А % % % % a a a * aa@ `,  `  * % a   "ЙH/`*"@* " ("`"("`"("`2" "БH/` ?    "ЛHo`@# @(# (# (# # `(# (# (# `"؛Ho`%  >" #  ``"Ho`K" ?RR#RR (??" `Ho`" `Ho`" `ԙH/`  0` `@"? ‐""""""""   㿘'8`@p&'4`& @&`Ho`"(`Ho`"@(`㿘'8`@=&'4& `>@&`"ЛHo` ::*` *"  (@+?@?# ?``Ho`"(`Ho`"@(`㿘'8`@&'4`& @&`"܀"( ? *㿘H/`'0 '1 ڐ "ЙH/`*"@* " ("`"("`"("`2""@ "БH/` ?    "ЛHo`# @(# (# (# # `(# (# (# #`"ԛHo`%  >" #  ``"Ho`K" ?RR#RR (??" `H/`"h@"h" "h "h H`"@*@""h("h""㿘H/`'0 " "'1 ""ݐ""""`"" ""@" " 㿘'8`@&'4`& @&`㿘"غH/`/`"/`. @(# ` 㿘'8`@f&'4`& @&`"ԛHo` @( (#!  `( (#! `"ԛHo`%  >" #  ``""ԗH`J""` *`` 2`` 2H` g0  g1 b"b *"БH/`( 㿘Ѐ@! 8@ ^?ꀦ@"*DY?H`.HD1; &&& & H&&4; -?H``` `?2?0. τ . . "#0" " 㿘`bbاH`  "  &a: * " a "a/ .@8@4/`?* @$g8.g4  *    $ 㿘""ԓHo`a>.&      &@&( !  . ! `㿘`""ԧH`a"aa .  * @ʒa*  @Œ`/  a.@> `*`$ a?> * $$$``/ a    * &a   㿘`""ԱH/`?a/`:@ `*`#n a: * #n$%a  /a@n* `?%/ a/`*`   W" aa ` *+**a@ @ @ @aa@> ` @@7 @@1 @@+,   /`   * @ *  @@*` 'a `` ?%a *` )" a a a * aa@ `,  `  /`  * 'a   ۸ 㿘    $#    $#? 㿘"УHo`$ې $ " @  * *`  $ `$  $ `Ho`" `㿘"H`    $#    $# P$  @*@ * @$ `*@ * @$ $ 㿘"H/``#  '`.`'`.`  `(   3.`'`(`.``'` ""Ho` # R`R`R` R` ( #  0# J" # `H`""@" Ho`" " `'8'4""`* * "`""ؗH`??   " B ? P  ""  # <4@ @ `` `"h    ` 2@"  @(*`    @(*`  J" @ J2  @(*`  J" @ J2  @(*` 2 @*  @ "* `* : *`J:`    J  㿘@&.`>`N?:N  H  J"J  J*8" JJ"JJ2J J   JH J*8 H J2  㿘 <4#h  N <4"#h Ӑ <4J@ <4*@`"#h㿘@ @&  @ ?  " ` @ ?2  ͼXͤx 㿘 <4N 0  N x   "h @ D "  "h D  `   *:  ? *: ?ɀ  @    D 2 `2&@ 㿘N -   @Є  J@`"* @ (Є Ё H<ۀ`@"<۬"`2 "`   0` `` - ` +`  `  '"`   0`/ `- ``- @ @  ,``@4&?   .  `.   0 . ` 0. ! . ` .   @  0.@ ?`   .`    .  @'HJ@ J@ % @,  H'H ?* : `<1" *` € H А ?H*`:  * H'H`H H?J`.'H А *`H :  * 'H H J h? l LHHJ 'HH @?ۑ* : `Sl <1 *` € ` ,` ,`v  ,` oH` <۲"`   ,   @,` I  , AH 2 l$/"@ %,+  @  %,H J@  @, 'Hl h*`:  bH 'HJ 2J@$,㿘'L'P'T'XL<#X㿘HHo`<[ad! 㿘 &N "HH/ <cP  <[!@ ǐ |€0!|@`㿘(*<aЀ   <S#؀`@ 0HHo`<[!`l€ /<K!`a @ *@aЀ <S#؀`@ 㿘HHo`<[!`t€ 0뒒 <[x"㿘<۠#h#<c8@4  ? c8@ " <[܁<H<T㿘 @5)<۠ ,``*  2     *     @  , @ѐ#p, *  *`&   ` @"`㿘 @F ,``*  @2    * @  , <@#, * *`   ` `@ " # *  *` "` ` @ "` 㿘<#<sd㿘 !d    &!d\ $0  <ڐ#!dR $<ܢ P @ʖ!@?@ `x@!@?" @ i*㿘HH<[!@ Xtt֬֬X,LL׈׌,  d ڄ ݠݠ㿘HHo`<#P`<5!*` €<[!`X<[!1<J   2?N ?; 㿘?HHo`<#P`<5!*` €<[!ܑ*`\€: <[!<J*``?  " 0? 㿘?* > 㿘. > ?X<#P`<5!ԓ*` €<[!`HJ    J 0  HHo`<[!`` #<ܠ`x@" 2m <ܤ `@ @?L`xO@ `OL @ ` OL @ ` @ Ĕ  <F <ܐ`@ @?<J  O  OJ@ ` OJ@ `@     <c8<ܒ`@n @O`J 2J :  Jab   X<#P`<5!*` €<[!`HJ    D 0HH/ !<[!  €@<ܐ `@ @`$#P<J`O` J`O  J`O  `@ "  #Pk ]!܀`!<J`O` J`O  J`O  `@   2F <c8<ܒ`@͖ @<5OJ``OJ@ ` OJ@ `@ ה  O J 2J :2 Jab    HJ@   0  㿘!<J 'H'L'P'T'X'H *  `:  t r @*  `㿘H/`<c<@L 㿘?  ` 8 㿘H/`<c<@& 㿘?  ` 8 㿘 `?HH/ <#<€  㿘ޒ4 ? ??HH/ <#<`  Ѱ 㿘!<K Ԗ ?? 㿘?㿘8@ 㿘?".㿘!<K <ܔ` `?㿘 <K! #<ܐ`Д ? ]  <ܔ`А~ & .@ <ܐ`ؔ8t     <8`< 0?㿘H/`<<€ > 㿘  <ܐ`1<ܰ 㿘  Ԑ1<ܰ PN<#8` <4"hN "{ʐNx '@/ *N `'`@`/*@_ 2NS @2LN  D "@NN  ,21 @#@ `l"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?`@ "?`"?`@`" `@`2  @*````: : : : ` `(`0`8: : (: 0: 8`@`H`P`X: @: H: P: X```h`p`x: `: h: p: x`ސ `p#`<>@#@a:?:?:?:?:?:?:?:?:?:?:?:?:?:?`@ :?``@`" `@`2  @*e    @`*"   @`*"  *? ` (   2@?`@?`@?`2`@`2`@+@0@"`(@2" `*3" ` +3@`"  2@+@0@1"@" @`*   *  @*  <?* #@ @ `x  *?*?  *?*?  *?*?  *?*?  *?*?  *?*?  *?*? @*ր```" "   `(( ** * "@ " `F  ""` `x: : : : : : (: 0: 8: @: H: P: X: `: h: p: x `2<?!#  :?:?:?:?:?:?:?:?:?:?:?:?:?:?:?:? ``" `2 2*` `2*? `   `   @@ ` !      @@!#@  3``?3``  3`` `2 # `  @ ``  @ `` +  +`@ @ `   "` ( 2@*(2    "`  @  <@7`p   @     @ @   ( @  0  8 @ @  @ H @  P  X @ @  ` h @  p  x @ @ @ ΐ `p3`0`!! Đ?? @ ?? @ ?? @ ??Ȕ @ ??ؔ @ ?? @ ?? @ @ `Y`   ` "@"  `"@   2``+  *`+`@ @`&Ӗ`    `2` ) `1@)) 1  `"` `@   ڀY`    "`"`@"`"` "`"`@"`€"`  ( 0 8"` "`$@"`("`,"`0"`4@"`8€"`< @ H P X"`@"`D@"`H"`L"`P"`T@"`X€"`\ ` h p x"``"`d@"`h"`l"`p"`t@"`x€"`| `@ ``pR`2<A #@ *#@a@ ??"""@"??"""@"??"""@"??Ȏ""Ď"Ȏ@"??؎"Ў"Ԏ"؎@"??"""@"??"""@"@   @ :`:`:`@:`€  ( 0@ 8:` :`(:`0@:`8€ @ H P@ X:`@:`H:`P@:`X€ ` h p@ x:``:`h:`p@:`x€ `@ `d`p` L "0` `  *@0`` "0` " 1  `3 ! *@*` 1 ` "`3 3 *@3 *` *`*`A@` 2)`1`0`" ``3  *@@ *``")` (*@@ )`1`@ @1` ` ( @* `  *! @ 0" *( @" *" p `" "`pp2 " `) @㿘6 ?򀖀 \2@" : 8: 0: (: : : : : : x: p: h: `: X: P: H: @: : : : : : : : : : : : : : : : ߐ! ````: : : : `8`0`(` : 8: 0: (: `X`P`H`@: X: P: H: @`x`p`h``: x: p: h: `````: : : : ````: : : : ````: : : : ````: : : : `!a`2  J " `2 2J @@   `4 J?" J?2J?" 2J?" 2" " 2 0   @ ( `(:  @ : @ 6`"" @ +`"" @  `"" @ `?" 4  @ `"4"   @  `*?"㿘   ?  b    8  b   S @ & F` @  & & `@ & :`  /   € @` €  ` : @ & F` @  & & `@ & :`w ?p #@? ?#  2@ <5`   @2 "@  T R . 3 + 6 . 6  .   @ "B ` @  ""€ `@ ":` ;  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82        b 㿘S @ & F` @  & & `@ & :`  V   € # C ` €  # # ` # :  @ & F` @  & & `@ & :`z ?s #@? ?#@  2@ <5 @  @2   W U " . 2 * 6. 6.    @ #C ` @  ## `@ #;`  : @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82      `   `   @@ ` !       @@!#@  "  03``?3``  3`` `"  # `` @`*" @`2" @`2"   0`倊` @ `"` 7 ````" " " " " " " " ` `(`0`8" " $" (" ," 0" 4" 8" <`@`H`P`X" @" D" H" L" P" T" X" \```h`p`x" `" d" h" l" p" t" x" |`ΐ `p3`<F1 @#@ `"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?`@ `"?"?`@`" `@`2  @*````: : : : ` `(`0`8: : (: 0: 8`@`H`P`X: @: H: P: X```h`p`x: `: h: p: x`ސ `p€`<F1 @#@ `H`" `  @`*"< ````2 2 2 2 `` ` `2 2 2 2 ` '  ` `* *  ` `* *  ` `* *  ` `* *  ` ` * * ` ` * * ` ` * * ` `* * `ސ  <F* #@ @ bЀ  *?*?  *?*?  *?*?  *?*?  *?*?  *?*?  *?*? @*ր```" "  D 2@h@"h``"h``"h`@2`@ @2`@ @@2(`H@ @x@H@ @H@! @H`@  @H`@)  @H`@  @H`@ (@H`@) (@ 2  2*2@   㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... initTERM=linuxHOME=/scdramfdsdpsdosdnsdmsdlsdksdjsdisdhsdgsdfsdesddsdcsdbsdaloopnfs/dev/bigphysarea=floppy=scsi_logging=max_scsi_luns=ether=kbd-resetconsole=panic=video=noinitrdramdisk_size=ramdisk=prompt_ramdisk=load_ramdisk=ramdisk_start=profile=reserve=ip=nfsaddrs=nfsroot=root=Calibrating delay loop... %lu.%02lu BogoMIPS rorwdebugquietinit=<2>initrd overwritten (0x%08lx < 0x%08lx) - disabling it. POSIX conformance testing by UNIFIX linuxrc/dev/console/linuxrc/initrd<3>Change root to /initrd: error %d Warning: unable to open an initial console. /sbin/init/etc/init/bin/init/bin/shNo init found. Try passing init= option to kernel.Linux version 2.2.19 (root@auric) (gcc version 2.95.2 20000220 (Debian GNU/Linux)) #1 Mon Apr 2 13:29:46 EDT 2001 mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeout___spinlock_waitfor___rw_read_enter___rw_read_exit___rw_write_enter___atomic_add___atomic_sub___set_bit___clear_bit___change_bit___set_le_bit___clear_le_bit%s[%d]: scall<%d> (could be %d) Aieee: sun4m NMI received! afsr=%08lx afar=%08lx you lose buddy boy... Aieee: sun4d NMI received! %c%08lx%c \|/ ____ \|/ "@'/ ,. \`@" /_| \__/ |_\ \__U_/ %s(%d): %s Caller[%08lx] Instruction DUMP:Unimplemented Sparc TRAP, type = %02lx Whee... Hello Mr. PenguinKernel bad trapKernel illegal instructionPenguin instruction from Penguin mode??!?!KERNEL MNA at pc %08lx npc %08lx called by %08lx BOGUSKernel gets FloatingPenguinUnit disabled trapWARNING: FPU exception from kernel mode. at pc=%08lx Too many Penguin-FPU traps from kernel modePenguin overflow trap from kernel modeTell me what a watchpoint trap is, and I'll then deal with such a beast...mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... machine: %s doesn't have irq handlers defined! %3d: %10u %c %s,%s %s + Trying to free bogus IRQ %d Trying to free free IRQ%d Trying to free free shared IRQ%d Trying to free shared IRQ%d with NULL device ID Attempt to free statically allocated IRQ%d (%s) IO device interrupt, irq = %d PC = %08lx NPC = %08lx FP=%08lx Expecting: [%s:%d:0x%x] AIEEE bogus interrupt receivedTrying to register fast irq when already shared. Trying to register fast irq as shared. request_fast_irq: Trying to register yet already owned. Fast IRQ%d (%s) SA_STATIC_ALLOC failed using kmalloc Attempt to mix fast and slow interrupts on IRQ%d denied Request for IRQ%d (%s) SA_STATIC_ALLOC failed using kmalloc Cannot initialize IRQ's on this Sun machine...mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... sun4m_get_irqmask: IRQ%d has no valid mask! %dobiocounterCannot find /obio/counter node regcounters_percpucounters_systemtimertime_init: unable to attach IRQ%d interruptCannot find /obio/interrupt node interrupts_percpuinterrupts_systemmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... timertime_init: unable to attach IRQ%d sun4c_interruptsinterrupt-enableCannot find /interrupt-enable noderegmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... %3d: %10u %c %s,%s %s + Trying to free free IRQ%d Trying to free free shared IRQ%d Trying to free shared IRQ%d with NULL device ID Attempt to free statically allocated IRQ%d (%s) Attempt to mix fast and slow interrupts on IRQ%d denied Request for IRQ%d (%s) SA_STATIC_ALLOC failed using kmalloc user timertimertime_init: unable to attach IRQ%d Clearing pending IRQs %08x on SBI %d %d%d,%xHalt failed!resetReboot failed!l0: %08lx l1: %08lx l2: %08lx l3: %08lx l4: %08lx l5: %08lx l6: %08lx l7: %08lx i0: %08lx i1: %08lx i2: %08lx i3: %08lx i4: %08lx i5: %08lx fp: %08lx i7: %08lx CPU[%d]: ARGS[%08lx,%08lx,%08lx,%08lx,%08lx,%08lx] FP[%08lx] CALLER[%08lx] sp: %08lx x0: %08lx x1: %08lx x2: %08lx x3: %08lx x4: %08lx x5: %08lx xx: %08lx s%d: %08lx PSR: %08lx PC: %08lx NPC: %08lx Y: %08lx g0: %08lx g1: %08lx g2: %08lx g3: %08lx g4: %08lx g5: %08lx g6: %08lx g7: %08lx o0: %08lx o1: %08lx o2: %08lx o3: %08lx o4: %08lx o5: %08lx sp: %08lx o7: %08lx mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... alloc_io: Mapping outside IOBASE area alloc_io: 0x%lx is already in use alloc_io: cannot occupy %d region alloc_dma: 0x%lx is already in use alloc_dvma: out of dvma memory mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... PROM SYNC COMMAND... Returning to prom KGDB: Entered KGDB: system interrupted OBP: system interrupted boot_flags_init: Halt! Unknown boot switch (-%c) kgdb=ttyKGDB: Using serial line /dev/ttya. KGDB: Using serial line /dev/ttyb. KGDB: Unknown tty line. console=ttyaUsing /dev/ttya as console. ttybUsing /dev/ttyb as console. prommem=%csun4 sun4csun4msun4dsun4esun4uARCH: SUN4 SUN4C SUN4M SUN4D SUN4E SUN4U AP1000 UNKNOWN! <2>initrd extends beyond end of memory (0x%08lx > 0x%08lx) disabling initrd MrCoffee ttya MrCoffee keyboard Inconsistent or unknown console Booted under KADB. Syncing trap table. Breakpoint! cpu : %s fpu : %s promlib : Version %d Revision %d prom : %d.%d type : %s ncpus probed : %d ncpus active : %d BogoMips : %lu.%02lu undeterminedSun4M OBP based systemSun4m SparcStation5Sun4m SparcStation10/20Sun4m SparcSystem600Sun4c SparcStation IPXSun4c SparcStation ELCSun4c SparcStation 2Sun4c SparcStation SLCSun4c SparcStation 1+Sun4c SparcStation IPCSun4c SparcStation 1Sun 4/400 SeriesSun 4/300 SeriesSun 4/200 SeriesSun 4/100 SeriesTYPE: %s banner-nameIDPROM: Bogus id_machtype value, 0x%x IDPROM: Unknown format type! IDPROM: Checksum failure (nvram=%x, calc=%x)! Ethernet address: %x:%x:%x:%x:%x:%x %s[%d]: Unimplemented SPARC system call %d 0123456789abcdefOKE03E01E02mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... CLOCK: Clock was stopped. Kick start . CLOCK: Kick start still on! CLOCK: Kick start procedure successful. obiocpu-unitbootbusCLOCK: Unsupported architecture! eepromCLOCK: No clock found! modelmk48t02regclock_probe: FAILED! clockmk48t08CLOCK: Unknown model name '%s' <2>NVRAM: Low battery voltage! Something wrong, clock regs not mapped yet. Fujitsu or Weitek on-chip FPUMatsushita MN10501TI MicroSparc on chip FPUSuperSparc on-chip FPUBIT B5010 or B5110/20 or B5210Cypress CY7C602 FPUTexas Instruments TMS390-C602ALsi Logic L64814ROSS HyperSparc combined IU/FPUNo FPUreservedLsi Logic/Meiko L64804 or compatibleWeitek WTL3170/2LSI Logic L64802 or Texas Instruments ACT8847Fujitsu MB86911 or Weitek WTL1164/5 or LSI L64831Fujitsu MB86910 or Weitek WTL1164/5UNKNOWN CPU-VENDOR/TYPEFujitsu or Weitek Power-UPSystems and Processes Engineering Corporation (SPEC)Harvest VLSI Design Center, Inc. - unknownPhilips Corporation - unknownMatsushita - MN10501Texas Instruments, Inc. - unknownTexas Instruments, Inc. - SuperSparc 61Texas Instruments, Inc. - SuperSparc 51Texas Instruments, Inc. - MicroSparc IITexas Instruments, Inc. - MicroSparcTexas Instruments, Inc. - SuperSparc 50LSI Logic Corporation - unknown-typeBipolar Integrated Technology - B5010ROSS HyperSparc RT625 or RT626ROSS HyperSparc RT620Cypress/ROSS CY7C611Cypress/ROSS CY7C601LSI Logic Corporation - L64811Fujitsu TurboSparc MB86907Fujitsu MB86904Fujitsu MB86900/1A or LSI L64831 SparcKIT-40DEBUG: psr.impl = 0x%x psr.vers = 0x%x DEBUG: psr.impl = 0x%x fsr.vers = 0x%x device_typeBooting Linux... cpumidFound CPU %d cpu-unitcpu-idNo CPU nodes found, cannot continue. Found %d CPU prom device tree node(s). mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... nameTadpoleobioclk-ctrlClock Stopping h/w detected... addressenabled (S3) enabled (%s) disabled %s mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... counter14ptrace: bad page directory %08lx ptrace: bad page middle %08lx %s [%d]: Wants to read user offset %ld %s [%d]: Wants to write user offset %ld No solaris handler Impossible unaligned trap. insn=%08x Byte sized unaligned access?!?!<1>Unable to handle kernel NULL pointer dereference in mna handler<1>Unable to handle kernel paging request in mna handler<1> at virtual address %08lx <1>current->mm->context = %08lx <1>current->mm->pgd = %08lx OopsUnsupported unaligned load/store trap for kernel at <%08lx>. Wheee. Kernel does fpu/atomic unaligned load/store.Impossible kernel unaligned trap.User FPU load/store unaligned unsupported. Impossible user unaligned trap.mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... %s: unimplemented SunOS MAP_NORESERVE mmap() flag %s: Call to sunos_sstk(increment<%d>) is unsupported VA_INVALIDATEVA_SEQUENTIALVA_ABNORMALVA_NORMAL%s: Advises us to use %s paging strategy BOGUSMADV_DONTNEEDMADV_WILLNEEDMADV_SEQUENTIALMADV_RANDOMMADV_NORMAL%s: Advises us to use %s paging strategy for addr<%08lx> len<%08lx> Process makes ni_syscall number %d, register dump: nfsext2iso9660minixufsWarning: UFS filesystem mounts unsupported. procsys_audit FDDI ioctl, returning EOPNOTSUPP mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... auxiliary-ioobioauxioledsCannot find auxio node, cannot continue... regauxiliaryIOpowerpower off control<6>Power off control detected. The machine has more banks than this kernel can support Increase the SPARC_PHYS_BANKS setting (currently %d) FAULT: NMI received SREGS: Synchronous Error %08lx Synchronous Vaddr %08lx Asynchronous Error %08lx Asynchronous Vaddr %08lx Memory Parity Error %08lx REGISTER DUMP: <1>Unable to handle kernel NULL pointer dereference<1>Unable to handle kernel paging request at virtual address %08lx <1>tsk->mm->context = %08lx <1>tsk->mm->pgd = %08lx OopsVM: killing process %s Mem-info: Free swap: %6dkB %d pages of RAM %d free pages %d reserved pages %d pages shared %d pages swap cached %ld page tables cached %ld page dirs cached paging_init: Cannot init paging on this Sparc paging_init: sparc_cpu_model = %d paging_init: Halting... Memory: %dk available (%dk kernel code, %dk data, %dk init) [%08lx,%08lx] load_mmu: %d unsupported panic: sparc_init_alloc botch DMA timeoutERROR: out of memory in asyncd MSC bug? setting write request MSC bug? failing request asyncdStarted asyncd mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... Bad pmd in pte_alloc: %08lx Bad pgd in pmd_alloc: %08lx Kernel faults at addr=0x%08lx PTE=%08lx SRMMU bolixed...out of mmu contextsHalting now... Wheee, kernel not mapped at all by boot loader. Wheee, kernel not mapped on 16MB physical boundry. Kernel mapped in non-existant memory. Wheee, kernel low mapping overflow. Some bank did not get mapped. [%d]: v[%08lx,%08lx](%lx) p[%08lx] SRMMU: Physical memory is contiguous, bypassing VA<->PA hashes. SRMMU: Compact physical memory. Using strightforward VA<->PA translations. device_typecpummu-nctxSomething wrong, can't find cpu node in paging_init. MMU type : %s invall : %d invmm : %d invrnge : %d invpg : %d contexts : %d Could not determine SRMMU chip type. cache-line-sizecan't determine cache-line-size, halting. cache-nlinescan't determine cache-nlines, halting. No CPU nodes found, halting. SRMMU: Using VAC size of %d bytes, line size %d bytes. ROSS HyperSparcROSS Cypress-604(UP)ROSS Cypress-605(MP)Fujitsu SwiftFujitsu TurboSparcTI TsunamiTI VikingTI Viking/MXCCpsr-implementationpsr-versionmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... regIOMMU registersCannot map IOMMU registers.Could not allocate iopte of size 0x%08x IOMMU: impl %d vers %d page table at %p of size %d bytes alloc_dvma: Cannot get a dvma page mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... regXPTCannot map External Page Table.iounit_get_area: Couldn't find free iopte slots for (%08lx,%d) alloc_dvma: Cannot get a dvma page iounit_map_dma_init: Couldn't find free iopte slots for %d bytes mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... SUN4C: AIEEE, trying to invalidate vac while it is on.No VAC. Get some bucks and buy a real computer.Cannot initialize VAC - wierd sun4 model idprom->id_machtype = %dvac-sizevac-linesizevac-hwflushvac_hwflushWEIRD Sun4C VAC cache size, tell davemprobe_vac: Didn't expect vac-linesize of %d, halting Unhandled number of segmaps: %d Unhandled number of contexts: %d Impossible VAC linesize %d, halting... No support for 4100 yet Invalid SUN4 model mmu-npmgmmu-nctxmemory parity errormemory-errorregSS2 cache bug detected, uncaching trap table page alloc_dvma: Cannot get a dvma page Kernel faults at addr 0x%08lx sun4c kernel fault handler bolixed...task union not %d page(s)! DMA vaddr=0x%p size=%08lx Out of iobuffer tableToo many tasks, decrease NR_TASK_BUCKETS please. vacsize : %d bytes vachwflush : %s vaclinesize : %d bytes mmuctxs : %d mmupsegs : %d kernelpsegs : %d kfreepsegs : %d usedpsegs : %d ufreepsegs : %d user_taken : %d max_taken : %d yesnosun4c_pte_free_kernel called, can't happen...sun4c_pmd_none for kernel pmd, can't happen...Bad pmd in pte_alloc_kernel: %08lx Bad pmd in pte_alloc: %08lx SUN4C: %d mmu entries for the kernel (out of %d) Loading sun4c MMU routines <3>%s(): keventd has not started current_is_keventdschedule_taskkeventdsignal_queue<2>SIG: sigpending lied <7>eh? notify_parent with state %ld? mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... ($ bug: kernel timer added twice at %p. <3>schedule_timeout: wrong timeout value %lx from %p Scheduling in interrupt <5>Clock: inserting leap second 23:59:60 UTC <5>Clock: deleting leap second 23:59:59 UTC WTZDSR%-8s %3d current %08lX %5lu %5d %6d %5d %7d %5d sig: %d %s %s : %d X free sibling task PC stack pid father child younger older DMA timeoutcascade%2d: %s Trying to free DMA%d Trying to free free DMA%d uid_cacheCannot create uid taskcount SLAB cache <3>copy_files: pid %d, open files %d exceeds max %d! files_cacheCannot create files cacheLinux<3>No execution domain for personality 0x%02lx <0>Kernel panic: %s <0>In swapper task - not syncing <0>In interrupt handler - not syncing <0>Rebooting in %d seconds..Press L1-A to return to the boot prom ttySttyattyS0ttybttyS1mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... <0>Restarting system. <0>System halted. <0>Power down. <0>Restarting system with command '%s'. <3>init_module: Invalid module header size. <3>A new version of the modutils is likely needed. <3>init_module: Size of initialized module exceeds size of created module. <3>init_module: mod->name out of bounds. <3>init_module: mod->syms out of bounds. <3>init_module: mod->deps out of bounds. <3>init_module: mod->init out of bounds. <3>init_module: mod->cleanup out of bounds. <3>init_module: mod->ex_table_* invalid. <3>init_module: mod->flags invalid. <3>init_module: mod->can_unload out of bounds. <3>init_module: changed module name to `%s' from `%s' <3>init_module: self-referential dependency in mod->deps. <3>init_module: found dependency that is (no longer?) a module. %8lu%4ld (deleted) (autoclean) (unused) (initializing) (uninitialized) [ ] %0*lx %s [%s] %0*lx %s task releasing itself Aiee, killing interrupt handler Attempted to kill the idle task!mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... %04lx-%04lx : %s 4K limit reached! warning: ioport table is full reservedunknownnonedevdebugfsprocnetvmkernelsysrqshmallshmmaxrtsig-maxrtsig-nrmodprobeprintkctrl-alt-delstop-areboot-cmdreal-root-devcap-boundpanicdomainnamehostnameversionosreleaseostypepage-clusterpagetable_cachekswapdpagecachebuffermemovercommit_memorybdflushfreepagesdentry-statedquot-maxdquot-nrsuper-maxsuper-nrfile-maxfile-nrinode-maxinode-stateinode-nr<4>SYSCTL: Can't register %s <1>Help - malformed sysctl tree on free %dPATH=/sbin:/usr/sbin:/bin:/usr/binTERM=linuxHOME=/-s-k<3>kmod: failed to exec %s -s -k %s, errno = %d <3>request_module[%s]: Root fs not mounted <3>kmod: runaway modprobe loop assumed and stopped <3>request_module[%s]: fork failed, errno %d <3>request_module[%s]: waitpid(%d,...) failed, errno %d free_one_pmd: bad directory entry %08lx free_one_pgd: bad directory entry %08lx <3>free_page_tables: Trying to free kernel pgd copy_pmd_range: bad pgd (%08lx) copy_pte_range: bad pmd (%08lx) forget_pte: old mapping existed! zap_pte_range: bad pmd (%08lx) zap_pmd_range: bad pgd (%08lx) put_dirty_page: trying to put page %08lx at %08lx mem_map disagrees with %08lx at %08lx put_dirty_page: pte %08lx already exists do_wp_page: bogus page at address %08lx (%08lx) bad page table directory entry %p:[%lx] find_vma_prev: tree inconsistent with list exit_mmap: map count is %d insert_vm_struct: tree inconsistent with list vm_area_structvma_init: Cannot alloc vm_area_struct cache.mm_structvma_init: Cannot alloc mm_struct cache.filemap_sync_pte_range: bad pmd (%08lx) filemap_sync_pmd_range: bad pgd (%08lx) <3>get_cached_page: page count=%d <3>get_cached_page: page already locked! put_cached_page: page not locked! put_cached_page: page count=%d Page cache hash table entries: %d (order %ld, %ldk) Failed to allocate page hash table change_pte_range: bad pmd (%08lx) change_pmd_range: bad pgd (%08lx) move_one_page: bad source pgd (%08lx) move_one_page: bad source pmd (%08lx) free_area_pte: bad pmd (%08lx) Whee.. Swapped out page in kernel page table free_area_pmd: bad pgd (%08lx) alloc_area_pte: page already exists Trying to vfree() bad address (%p) Trying to vfree() nonexistent vm area (%p) size-131072size-65536size-32768size-16384size-8192size-4096size-2048size-1024size-512size-256size-128size-64size-32kmem_cachekmem_cache_init(): Offsets are wrong - I've been messed with!slab_cachekmem_cache_sizes_init: Error creating caches<3>kmem_create: %sNULL ptr %sCalled during int - %s %sSize too small %d - %s %sSize too large %d - %s %sDecon but no con - %s %sOffset weird %d - %s %sIllgl flg %lX - %s %sForcing size word alignment - %s %sDup name - %s <3>kmem_shrink: NULL ptr <3>kmem_shrink: Called during int - %s <3>kmem_shrink: Invalid cache addr %p <3>kmem_destroy: NULL ptr <3>kmem_destroy: Called during int - %s <3>kmem_destroy: Invalid cache addr %p <3>kmem_destroy: Can't free all objects %p <4>kmem_grow: Illegal flgs %X (correcting) - %s <3>kmem_grow: Called nonatomically from int - %s <3>kmem_alloc: %s (name=%s) unknown<3>kmem_free: %s (objp=%p, name=%s) Bad slab magic (corrupt)NULL ptrfree with no active objsEither bad obj addr or double freefree from inactive slabBad obj addr<3>kmalloc: Size (%lu) too large <3>kfree: Bad obj %p <3>kfree_s: Bad obj %p kmem_cache_reap() called within int! <3>kmem_reap: Corrupted cache struct for %s slabinfo - version: 1.0 %-17s %6lu %6lu DMA timeoutswap_out_pmd: bad pmd (%08lx) swap_out_pgd: bad pgd (%08lx) $Revision: 1.5 $Starting kswapd v%.*s kswapdInternal error: bad swap-device rw_swap_page: weirdness <3>rw_swap_page: Trying to %s unallocated swap (%08lx) readwrite<3>rw_swap_page: Trying to swap to unused swap-device <3>VM: swap page is unlocked swap entry mismatchrw_swap_page: bad swap file <3>rw_swap_page: no swap file or device swap_after_unlock_page: lock already cleared <3>rw_swap_page: page unused while waiting! swap_after_unlock_page: bad swap-device swap_after_unlock_page: weirdness Tried to swap a non-swapper pageVM: swap page is not in swap cache VM: read_swap_page: page already in swap cache! VM: read_swap_page: page already in page cache! VM: rw_swap_page_nolock: page not locked! VM: rw_swap_page_nolock: page in swap cache! DMA timeoutFreeing swap cache page__get_free_pages local_pages list corrupted I__get_free_pages local_pages list corrupted IIFree pages: %6dkB ( Free: %d (%d %d %d) %sDMA: Non%lu*%lukB = %lukB) Swap cache: add %ld, delete %ld, find %ld/%ld <3>swap_cache: replacing non-empty entry %08lx on page %08lx <3>swap_cache: replacing page-cached entry on page %08lx <4>swap_duplicate: entry %08lx map count=%d <3>swap_duplicate: entry %08lx, nonexistent swap file <3>swap_duplicate: entry %08lx, offset exceeds max <3>swap_duplicate at %8p: entry %08lx, unused page <3>swap_count: null entry! <3>swap_count: entry %08lx, nonexistent swap file! <3>swap_count: entry %08lx, offset exceeds max! <3>swap_count at %8p: entry %08lx, unused page! VM: Removing swap cache page with zero inode hash on page %08lx VM: Removing swap cache page with wrong inode hash on page %08lx <3>VM: Found a non-swapper swap page! swap_free: Trying to free nonexistent swap-page swap_free: Trying to free swap from unused swap-device swap_free: offset exceeds max swap_free: swap-space map bad (entry %08lx) unuse_pmd: bad pmd (%08lx) unuse_pgd: bad pgd (%08lx) <3>try_to_unuse: entry %08lx count=%d Filename Type Size Used Priority %-31s file partition %d %d %d Unable to start swapping: out of memory :-) SWAP-SPACESWAPSPACE2Unable to find swap-space signature <4>Unable to handle swap header version %d <4>Swap area shorter than signature indicates <4>Empty swap-file <6>Adding Swap: %dk swap-space (priority %d) bigphysarea: Allocated %d pages at 0x%08lx. bigphysarea_free_pages(0x%08x), not allocated! No big physical area allocated! Big physical area, size %ld kB free list: used list: number of blocks: %8d %8d size of largest block: %8d kB %8d kB total: %8d kB %8d kB chown_common: NULL inode get_unused_fd: slot %d not NULL! VFS: Close: file count is 0 Character devices: %3d %s Block devices: block-major-%dchar-major-%d<7>VFS: Disk change detected on device %s VFS: busy inodes on changed media. %02x:%02xunknown-block%s(%d,%d)unknown-charfilpVFS: Cannot alloc filp SLAB cache.VFS: filp allocation failed VFS: file-max limit %d reached mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... VFS: LRU block list corruptedLRU list corruptedVFS: Free block list corruptedFree list corruptedFree list emptyB_FREE inserted into queuesVFS: buffer LRU pointers corruptedInvalid blocksize passed to set_blocksize<4>set_blocksize: dev %s buffer_dirty %lu size %lu <4>set_blocksize: b_count %d, dev %s, block %lu, from %p Attempt to refile free buffer VFS: brelse: Trying to free free buffer Whoops: end_buffer_io_async: async io complete on unlocked page Whoops: end_buffer_io_async: b_count != 1 on async io. brw_page: page not locked for I/OVFS: grow_buffers: size = %d PROTECTEDDIRTYLOCKEDCLEANBuffer memory: %8ldkB Buffer heads: %6d Buffer blocks: %6d Buffer hashed: %6d %9s: %d buffers, %d used (last=%d), %d locked, %d protected, %d dirty Buffer cache hash table entries: %d (order %d, %ldk) Failed to allocate buffer hash table buffer_headCannot create buffer head SLAB cache Dirty list empty %d kflushdkupdateunknownnone,nodiratime,noatime,mand,sync,nodev,nosuid,noexec,nolock,noac,nocto,tcp,posix,intr,soft%s %s %s %srorwnfs,v%d,rsize=%d,wsize=%d,acregmin=%d,acregmax=%d,acdirmin=%d,acdirmax=%d,addr=%s 0 0 %s %s nodevVFS: empty superblock %p locked! VFS: on device %s: get_fs_type(%s) failed VFS: put_unnamed_dev: freeing unused device %s VFS: mount - already mounted VFS: Busy inodes after unmount. Self-destruct in 5 seconds. Have a nice day... /dev/root/<5>VFS: Mounted root (NFS filesystem)%s. readonly<3>VFS: Unable to mount root fs via NFS, trying floppy. <5>VFS: Insert root floppy and press ENTER VFS: Cannot open root device %s VFS: Mounted root (%s filesystem)%s. VFS: add_vfsmnt failed for root fsVFS: Unable to mount root fs on %s<2>New root is busy. Staying in initrd. change_root: old root has d_count=%d <5>Trying to unmount old root ... okay <3>error %d /dev/root.old<2>Trouble: add_vfsmnt failed binfmt-%04xusr/gnemul/sunos/usr/gnemul/solaris/<3>dupfd: fd %d, max %d kill_fasync: bad magic number in fasync_struct! Attempting to free lock with active wait queueAttempting to free lock with active block list<3>locks_insert_block: remove duplicated lock (pid=%d %ld-%ld type=%d) <4>fcntl_setlk() called by process %d (%s) with broken flock() emulation locks_conflict(): impossible lock type - %d %d:%s %6s %s ACCESSPOSIX MANDATORYADVISORY FLOCK ADVISORY %s READ WRITE%d %s:%ld %ld %ld %08lx %08lx %08lx %08lx %08lx ->unknownnoneEFS: 1.0b - (c) 1999 Al Smith <3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! nfsd<2>Negative d_count (%d) for %s/%s /<4>VFS: moving negative dcache entry (deleted)dentry_cacheCannot create dentry cacheDentry hash table entries: %d (order %d, %ldk) Failed to allocate dcache hash table write_inode_now: no super block <4>grow_inodes: inode-max limit reached grow_inodes: allocation failed <3>iput: inode %s/%ld still has locks! <3>iput: device %s inode %ld still has aliases! <3>iput: device %s inode %ld count changed, count=%d <3>iput: Aieee, semaphore in use inode %s/%ld, count=%d <3>iput: Aieee, atomic write semaphore in use inode %s/%ld, count=%d <3>iput: inode %s/%ld count wrapped <3>free_fd_arrayarray = 0 (num = %d) <3>free_fdsetarray = 0 (num = %d) ELF/usr/lib/libc.so.1/usr/lib/ld.so.1<4>ELF: Ambiguous type, using ELF %d<3>Unable to load interpreter %.128s ELFcore.CORERSDZTDelf_core_dump: file->f_pos (%ld) != offset (%ld) freeundos undo list error id=%d sem_exit undo list error id=%d shm nono: killseg called on unused seg id=%d shm nono: killseg shp->pages=NULL. id=%d shm_open: unused id=%d PANIC ext2_get_group_descblock_group >= groups_count - block_group = %d, groups_count = %luGroup descriptor not loaded - block_group = %d, group_desc = %lu, desc = %luread_block_bitmapCannot read block bitmap - block_group = %d, block_bitmap = %luload_block_bitmapblock_group != block_bitmap_numberext2_free_blocks: nonexistent deviceext2_free_blocksFreeing blocks not in datazone - block = %lu, count = %luFreeing blocks in system zones - Block = %lu, count = %lubit already cleared for block %luext2_new_block: nonexistent deviceext2_new_blockFree blocks count corrupted for block group %dAllocating block in system zone - block = %ubit already set for block %dblock >= blocks count - block_group = %d, block=%dcannot get block %dext2_check_blocks_bitmapSuperblock in group %d is marked freeDescriptor block #%d in group %d is marked freeBlock bitmap for group %d is marked freeInode bitmap for group %d is marked freeBlock #%d of the inode table in group %d is marked freeWrong free blocks count for group %d, stored = %d, counted = %luWrong free blocks count in super block, stored = %lu, counted = %lurec_len is smaller than minimalrec_len % 4 != 0rec_len is too small for name_lendirectory entry across blocksinode out of boundsbad entry in directory #%lu: %s - offset=%lu, inode=%lu, rec_len=%d, name_len=%dext2_readdirdirectory #%lu contains a hole at offset %luext2_file_write: inode = NULL ext2_file_writemode = %07oread_inode_bitmapCannot read inode bitmap - block_group = %lu, inode_bitmap = %luload_inode_bitmapblock_group >= groups_count - block_group = %d, groups_count = %lublock_group != inode_bitmap_numberext2_free_inode: inode has no device ext2_free_inode: inode has count=%d ext2_free_inode: inode has nlink=%d ext2_free_inode: inode on nonexistent device free_inodereserved inode or nonexistent inodeext2_free_inodebit already cleared for inode %luext2_new_inodebit already set for inode %dFree inodes count corrupted in group %dreserved inode or inode > inodes count - block_group = %d,inode=%dext2_check_inodes_bitmapWrong free inodes count in group %d, stored = %d, counted = %luWrong free inodes count in super block, stored = %lu, counted = %luext2_alloc_blockcannot get block %luext2_block_to_pathblock < 0block > bigext2_read_inodebad inode number: %lugroup >= groups countDescriptor not loadedunable to read inode block - inode=%lu, block=%luNew inode has non-zero prealloc count!ext2_write_inodeIO error syncing ext2 inode [%s:%08lx] ext2_find_entryext2_add_entryext2_delete_entry...empty_dirbad directory (dir #%lu) - no data blockbad directory (dir #%lu) - no `.' or `..'ext2_rmdirempty directory has nlink!=2 (%d)ext2_unlinkDeleting nonexistent file (%lu), %dEXT2-fs panic (device %s): %s: %s <2>EXT2-fs error (device %s): %s: %s Remounting filesystem read-only <4>EXT2-fs warning (device %s): %s: %s ,bsddfchecknonenormalstrictEXT2-fs: Invalid check option: %s debugerrorsEXT2-fs: the errors option requires an argument continueremount-ropanicEXT2-fs: Invalid errors option: %s grpidbsdgroupsminixdfnochecknogrpidsysvgroupsresgidEXT2-fs: the resgid option requires an argumentEXT2-fs: Invalid resgid option: %s resuidEXT2-fs: the resuid option requires an argumentEXT2-fs: Invalid resuid option: %s sbEXT2-fs: the sb option requires an argumentEXT2-fs: Invalid sb option: %s grpquotanoquotaquotausrquotaEXT2-fs: Unrecognized mount option %s EXT2-fs warning: revision level too high, forcing read/only mode EXT2-fs warning: mounting unchecked fs, running e2fsck is recommended EXT2-fs warning: mounting fs with errors, running e2fsck is recommended EXT2-fs warning: maximal mount count reached, running e2fsck is recommended EXT2-fs warning: checktime reached, running e2fsck is recommended [EXT II FS %s, %s, bs=%lu, fs=%lu, gc=%lu, bpg=%lu, ipg=%lu, mo=%04lx] 0.5b95/08/09ext2_check_descriptorsBlock bitmap for group %d not in group (block %lu)!Inode bitmap for group %d not in group (block %lu)!Inode table for group %d not in group (block %lu)!EXT2-fs: unable to read superblock VFS: Can't find an ext2 filesystem on dev %s. EXT2-fs: %s: couldn't mount because of unsupported optional features. EXT2-fs: %s: couldn't mount RDWR because of unsupported optional features. EXT2-fs: blocksize too small for device. EXT2-fs: Couldn't read superblock on 2nd try. EXT2-fs: Magic mismatch, very weird ! EXT2-fs: unsupported inode size: %d VFS: Unsupported blocksize on dev %s. EXT2-fs: fragsize %lu != blocksize %lu (not supported yet) EXT2-fs: #blocks per group too big: %lu EXT2-fs: #fragments per group too big: %lu EXT2-fs: #inodes per group too big: %lu EXT2-fs: not enough memory EXT2-fs: unable to read group descriptors EXT2-fs: group descriptors corrupted ! EXT2-fs: get root inode failed ext2trunc_indirectRead failure, inode=%ld, block=%dtrunc_dindirecttrunc_tindirectprocde_put: entry %s already free! de_put: deferred delete of %s ,uidgidproc_iget: using deleted entry %s, count=%d proc_get_inode: inode fubar proc_read_super: get root inode failed /procsysopenpromfsopenprom%dloadavguptimememinfokmsgversioncpuinfoselfkcoremodulesksymsstatdevicespartitionsinterruptsfilesystemsfsdmaioportscmdlinebigphysarealocksmountsswapsprofileslabinfonetscsibus...statusmemcwdrootexefdenvironcmdlinestatstatmmapsremove_proc_entry: %s/%s busy, count=%d mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... Bad page dir entry %08lx Bad page middle entry %08lx Bad source page dir entry %08lx Bad source page middle entry %08lx socket:[%lu]pipe:[%lu]..mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... %d.%02d %d.%02d %d.%02d %d/%d %d cpu %u %u %u %lu disk %u %u %u %u disk_rio %u %u %u %u disk_wio %u %u %u %u disk_rblk %u %u %u %u disk_wblk %u %u %u %u page %u %u swap %u %u intr %u %u ctxt %u btime %lu processes %lu %lu.%02lu %lu.%02lu total: used: free: shared: buffers: cached: Mem: %8lu %8lu %8lu %8lu %8lu %8lu Swap: %8lu %8lu %8lu MemTotal: %8lu kB MemFree: %8lu kB MemShared: %8lu kB Buffers: %8lu kB Cached: %8lu kB SwapTotal: %8lu kB SwapFree: %8lu kB %s get_phys_addr: pid %d has NULL pgd! bad page directory entry %08lx bad page middle entry %08lx Name: W (paging)T (stopped)Z (zombie)D (disk sleep)S (sleeping)R (running)State: %s Pid: %d PPid: %d Uid: %d %d %d %d Gid: %d %d %d %d Groups: %d VmSize: %8lu kB VmLck: %8lu kB VmRSS: %8lu kB VmData: %8lu kB VmStk: %8lu kB VmExe: %8lu kB VmLib: %8lu kB SigPnd: SigBlk: SigIgn: SigCgt: CapInh: %016x CapPrm: %016x CapEff: %016x %d (%s) %c %d %d %d %d %d %lu %lu %lu %lu %lu %lu %lu %ld %ld %ld %ld %ld %ld %lu %lu %ld %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %d %d statm_pte_range: bad pmd (%08lx) statm_pmd_range: bad pgd (%08lx) %d %d %d %d %d %d %d %08lx-%08lx %s %08lx %s %lumapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... No low-level scsi modules are currently present %d-%d%dsystem:/dev/ttysystem:consolesystem:vtmastersystemconsoleserial:calloutserialpty:masterpty:slaveptytype:%d.%d%-20s /dev/%-8s %3d %7s %s unknown%-10s %2d ???ttytty/ldisctty/drivertty/ldiscstty/drivers...,norocknojolietunhidecruftutf8iocharsetmapanooffnormalacorncheckrsrelaxedstrictconvbtmabinarytextmtextautoblockmodeuidgid<3>Session %d start %d type %d <3>Invalid session number or type of track CD001<7>ISO 9660 Extensions: Microsoft Joliet Level %d CDROMcp437<7>ISOFS: changing to secondary root <4>isofs_read_super: root inode not initialized <4>isofs_read_super: get root inode failed <4>isofs_read_super: bread failed, dev=%s, iso_blknum=%d, block=%d <4>Bad logical zone size %ld <4>Logical zone size(%d) < hardware blocksize(%u) <4>Unable to identify CD-ROM format. _isofs_bmap: block<0_isofs_bmap: block>= EOF(%d, %ld) isofs_bmap: More than 100 file sections ?!?, aborting... isofs_bmap: ino=%lu block=%d firstext=%u size=%u nextino=%lu <6>ISOFS: unable to read i-node block %lu <6>isofs_read_level3_size: More than 100 file sections ?!?, aborting... isofs_read_level3_size: inode=%lu ino=%lu <6>isofs_read_inode: out of memory <4>Warning: defective cdrom. Enabling "cruft" mount option. Interleaved files not (yet) supported. File unit size != 0 for ISO file (%ld). Warning: defective cdrom (volume sequence number %d). Enabling "cruft" mount option. <4>ISOFS: unable to read i-node block iso9660ARCHIMEDES%3.3x...Unable to read rock-ridge attributes Unsupported NM flag settings (%d) <7>ISO 9660 Extensions: %c Symlink component flag not implemented <4>Attempt to read inode for relocated directory Cannot have symlink with high sierra variant of iso filesystem .../Symlink component flag not implemented (%d) unable to read i-node blocksymlink spans iso9660 blocks unknownnonenfsNFS: put_inode(%x/%ld) NFS: delete_inode(%x/%ld) <5>nfs_get_root: getattr error = %d <5>nfs_read_super: missing data argument <4>nfs warning: mount version %s than kernel oldernewer<4>NFS: mount program passes invalid filehandle! <4>NFS: mount program didn't pass remote address! <5>NFS: cannot create RPC transport. <5>NFS: cannot create RPC client <5>NFS: cannot start rpciod! <5>NFS: cannot retrieve file system info. <5>NFS: cannot initialize writeback cache. <5>NFS: cannot create RPC transport. <5>nfs_statfs: statfs error = %d NFS: nfs_fhget(%s/%s fileid=%Lu) NFS: __nfs_fhget(%x/%Ld ct=%d) <5>__nfs_fhget: iget failed <7>nfs_notify_change: revalidate failed, error=%d NFS: revalidating (%x/%Ld) nfs_revalidate_inode: (%x/%Ld) getattr failed, error=%d nfs_revalidate_inode: (%x/%Ld) refresh failed, error=%d NFS: (%x/%Ld) revalidation complete <3>nfs_refresh_inode: inode or fattr is NULL <3>nfs_refresh_inode: empty inode NFS: refresh_inode(%x/%ld ct=%d info=0x%x) <3>nfs_refresh_inode: inode number mismatch expected (0x%lx%08lx/0x%lx%08lx), got (0x%lx%08lx/0x%lx%08lx) <7>nfs_refresh_inode: inode %ld mode changed, %07o to %07o unknownnonenfs: flush(%x/%ld) nfs: read(%s/%s, %lu@%lu) nfs: mmap(%s/%s) nfs: fsync(%x/%ld) nfs: write(%s/%s(%ld), %lu@%lu) <6>NFS: attempt to write to active swap file! NFS: nfs_lock(f=%4x/%ld, t=%x, fl=%x, r=%ld:%ld) unknownnone<3>NFS: Invalid unlock attempted NFS: nfs_readpage_sync(%p) NFS: nfs_proc_read(%s, (%x/%Ld), %ld, %d, %p) NFS: %4d initiated read call (req %x/%Ld count %d nriov %d. <3>NFS: desynchronized value of nfs_i.nread. NFS: %4d nfs_readpage_result, (status %d) NFS: read (%x/%Ld %d@%ld) NFS: nfs_readpage (%p %ld@%lu) <3>Aiee.. nfs swap-in of page failed! unknownnone<3>NFS: Invalid unlock attempted NFS: nfs_writepage_sync(%x/%Ld %d@%ld) <3>NFS: short write, size=%u, result=%d <3>NFS: unlocked request attempted hashed! <3>NFS: unlocked request attempted unhashed! <3>NFS: desynchronized value of nfs_i.npages. <3>NFS: Add to list failed! <3>NFS: unlocked request attempted added to list! <3>NFS: unlocked request attempted removed from list! NFS: hit soft limit (%d requests) NFS: create_request sleeping (total %d pid %d) NFS: create_request waking up (tot %d pid %d) <3>NFS: Request released while still on a list! <3>NFS: Request released while still hashed! <3>NFS: Request released while still locked! <3>NFS: desynchronized value of nfs_i.ndirty. <3>NFS: desynchronized value of nfs_i.ncommit. NFS: nfs_updatepage(%s/%s %d@%ld, sync=%d) NFS: nfs_updatepage returns %d (isize %ld) NFS: %4d initiated write call (req %x/%Ld count %d nriov %d) NFS: %4d nfs_writeback_done (status %d) <4>NFS: Server wrote less than requested. NFS: faulty NFSv3 server %s: (committed = %d) != (stable = %d) NFS: write (%x/%Ld %d@%Ld), error = %d OK marked for commit NFS: %4d initiated commit call NFS: %4d nfs_commit_done (status %d) NFS: commit (%x/%Ld %d@%ld) mismatch unknownnoneNFS: nfs_readdir_filler() reading cookie %Lu into page %lu. NFS: found cookie %Lu NFS: find_dirent() returns %d NFS: find_dirent_page() searching directory page %ld NFS: find_dirent_page() returns %d NFS: readdir_search_pagecache() searching for cookie %Lu NFS: readdir_search_pagecache() returned %d NFS: nfs_do_filldir() filling starting @ cookie %Lu NFS: nfs_do_filldir() filling ended @ cookie %Lu; returning = %d NFS: uncached_readdir() searching for cookie %Lu NFS: uncached_readdir() returns %d nfs_lookup_validate: %s/%s has dud inode NFS: lookup(%s/%s) NFS: create(%x/%ld, %s NFS: mknod(%x/%ld, %s NFS: mkdir(%x/%ld, %s) NFS: rmdir(%x/%ld, %s NFS: silly-rename(%s/%s, ct=%d) <3>NFS: silly-renaming %s/%s, negative dentry?? .nfs%*.*lx%*.*xtrying to rename %s to %s NFS: safe_remove(%s/%s) <3>nfs_safe_remove: %s/%s already negative?? <6>nfs_safe_remove: %s/%s busy, d_count=%d NFS: unlink(%x/%ld, %s) NFS: symlink(%x/%ld, %s, %s) <4>nfs_proc_symlink: %s/%s not negative! <6>nfs_proc_symlink: %s/%s already exists?? NFS: link(%s/%s -> %s/%s) NFS: rename(%s/%s -> %s/%s, ct=%d) <6>nfs_rename: target %s/%s busy, d_count=%d <6>nfs_rename: new dentry %s/%s busy, d_count=%d unknownnoneunknownnoneNFS call getroot NFS reply getroot NFS call getattr NFS reply getattr NFS call setattr NFS reply setattr NFS call lookup %s NFS reply lookup: %d NFS call readlink NFS reply readlink: %d NFS call read %d @ %ld NFS reply read: %d NFS call write %d @ %ld NFS reply write: %d NFS call create %s NFS reply create: %d NFS call mknod %s NFS reply mknod: %d NFS call remove %s NFS reply remove: %d NFS call rename %s -> %s NFS reply rename: %d NFS call link %s NFS reply link: %d NFS call symlink %s -> %s NFS reply symlink: %d NFS call mkdir %s NFS reply mkdir: %d NFS call rmdir %s NFS reply rmdir: %d NFS call readdir %d NFS reply readdir: %d NFS call statfs NFS reply statfs: %d unknownnone<3>NFS: Bad number of iov's in xdr_readargs <4>NFS: Odd RPC header size in read reply: %d NFS: Short READ header. iovec will be shifted. RPC: readres OK count %d <3>NFS: Bad number of iov's in xdr_writeargs (nr %d max %d) <4>NFS: Odd RPC header size in READDIR reply: %d NFS: Short READDIR header. iovec will be shifted. <3>NFS: Bad result buffer in readdir <4>NFS: giant filename in readdir (len 0x%x)! <5>NFS: short packet in readdir reply! <4>NFS: Odd RPC header size in READLINK reply: %d NFS: Short READLINK header. iovec will be shifted. <3>nfs_stat_to_errno: bad nfs status return value: %d nfs_statfsnfs_readdirnfs_rmdirnfs_mkdirnfs_symlinknfs_linknfs_renamenfs_removenfs_createnfs_writenfs_writecachenfs_readnfs_readlinknfs_lookupnfs_rootnfs_setattrnfs_getattrnfs_nullunknownnonenfs_flushdNFS: writecache_init NFS: reqlist_exit (ptr %p rpc %p) NFS: %4d flushd starting NFS: %4d flushd back to sleep unknownnonenfs_delete_queueunknownnoneacdirmaxacdirminacregmaxacregminretranstimeowsizersizeportbroken_suidtcpudpv3v2nolocklocknoacacnoctoctonoposixposixnointrintrhardsoft,default/tftpboot/%s<3>Root-NFS: Pathname for remote directory too long. <3>Root-NFS: No NFS server available, giving up. <5>Looking up port of RPC %d/%d on %s <3>Root-NFS: Unable to get nfsd port number from server, using default Root-NFS: Portmapper on server returned %d as nfsd port <3>Root-NFS: Unable to get mountd port number from server, using default Root-NFS: mountd port is %d <3>Root-NFS: Server returned error %d while mounting %s unknownnoneNFS: nfs_mount(%08x:%s) mnt_mountmnt_nullmnt3_mountmnt3_nullmountunknownnoneNFS call getroot NFS reply getroot NFS call getattr NFS reply getattr NFS call setattr NFS reply setattr NFS call lookup %s NFS reply lookup: %d NFS call access NFS reply access NFS call readlink NFS reply readlink: %d NFS call read %d @ %ld NFS reply read: %d NFS call write %d @ %ld NFS call create %s NFS reply create: %d NFS call setattr (post-create) NFS reply setattr (post-create): %d NFS call remove %s NFS reply remove: %d NFS call rename %s -> %s NFS reply rename: %d NFS call link %s NFS reply link: %d NFS call symlink %s -> %s NFS reply symlink: %d NFS call mkdir %s NFS reply mkdir: %d NFS call rmdir %s NFS reply rmdir: %d NFS call readdir%s %d plusNFS reply readdir: %d NFS call mknod %s %x NFS reply mknod: %d NFS call fsstat NFS reply statfs: %d unknownnone<3>NFS: Bad number of iov's in xdr_readargs <3>NFS: Bad number of iov's in xdr_writeargs <4>NFS: Odd RPC header size in READDIR reply: %d NFS: Short READDIR header. iovec will be shifted. <4>NFS: giant filename in readdir (len %x)! <4>NFS: giant filehandle in readdir (len %x)! <5>NFS: short packet in readdir reply! NFS: FH truncated <4>NFS: Odd RPC header size in READLINK reply: %d NFS: Short READLINK header. iovec will be shifted. <4>NFS: READ count doesn't match RPC opaque count. <4>NFS: Odd RPC header size in read reply: %d NFS: Short READ header. iovec will be shifted. <4>NFS: server cheating in read reply: count %d > recvd %d nfs3_commitnfs3_pathconfnfs3_fsinfonfs3_fsstatnfs3_readdirplusnfs3_readdirnfs3_linknfs3_renamenfs3_rmdirnfs3_removenfs3_mknodnfs3_symlinknfs3_mkdirnfs3_createnfs3_writenfs3_readnfs3_readlinknfs3_accessnfs3_lookupnfs3_setattrnfs3_getattrnfs3_nullunknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: CANCEL call failed (errno %d) <4>lockd: Uh-oh! Interfering reclaims for host %sunknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! %d@%s<5>NFSv4 file locking not implemented! lockd: clnt proc returns %d nlmclnt_alloc_call: failed, waiting for memory lockd: call procedure %s on %s lockd: rpc_call returned error %d lockd: server in grace period <4>lockd: spurious grace period reject?! lockd: server returns status %d lockd: call procedure %s on %s (async) <5>lockd: failed to monitor %s <4>lockd: failed to reclaim lock for pid %d (errno %d, status %d) lockd: unexpected unlock status: %d lockd: unlock failed (err = %d) lockd: CANCEL call error %d, retrying. lockd: cancel status %d (task %d) lockd: CANCEL failed (server has no locks) <5>lockd: weird return %d for CANCEL call <5>lockd: unexpected status NLM_BLOCKED <5>lockd: unexpected server status %d unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: attempt to create host entry failed. lockd: creating host entry. %d.%d.%d.%d<5>lockd: no clnt or addr in lookup_host! lockd: nlm_lookup_host(%08x, p=%d, v=%d) lockd: nlm_bind_host(%08x) lockd: next rebind in %ld jiffies lockd: couldn't create RPC handle for %s lockd: rebind host %s lockd: get host %s lockd: release host %s lockd: shutting down host module lockd: nuking all hosts... <4>lockd: couldn't shutdown host module! lockd: %d hosts left: %s (cnt %d use %d exp %ld) lockd: host garbage collection lockd: delete host %s unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockdNFS locking service started (ver 0.4). <4>lockd: terminating on error %d lockd: request from %08x <7>lockd: new process, skipping host shutdown <4>lockd_up: no pid, %d users?? <4>lockd_up: create service failed <4>lockd_up: makesock failed, error=%d <4>lockd_up: create thread failed, error=%d <4>lockd_down: no users! pid=%d <4>lockd_down: no lockd running. <4>lockd_down: lockd failed to exit, clearing pid unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: nlmsvc_insert_block(%p, %ld) lockd: nlmsvc_lookup_block f=%p pd=%d %ld-%ld ty=%d lockd: check f=%p pd=%d %ld-%ld ty=%d cookie=%x cookie: head of blocked queue %p, block %p lockd: created block %p... lockd: deleting block %p... lockd: deleting granted lock lockd: unblocking blocked lock lockd: nlmsvc_lock(%04x/%ld, ty=%d, pi=%d, %ld-%ld, bl=%d) lockd: posix_lock_file returned %d lockd: blocking on this lock (allocating). lockd: blocking on this lock. lockd: nlmsvc_testlock(%04x/%ld, ty=%d, %ld-%ld) lockd: conflicting lock(ty=%d, %ld-%ld) somehostlockd: nlmsvc_unlock(%04x/%ld, pi=%d, %ld-%ld) lockd: nlmsvc_cancel(%04x/%ld, pi=%d, %ld-%ld) lockd: VFS unblock notification for block %p <4>lockd: notification for unknown block! lockd: grant blocked lock %p lockd: lock still blocked <4>lockd: unexpected error %d in %s! nlmsvc_grant_blockedlockd: GRANTing blocked lock. lockd: GRANT_MSG RPC callback callback: looking for cookie %x lockd: no block for cookie %x nlmsvc_retry_blocked(%p, when=%ld) nlmsvc_retry_blocked(%p, when=%ld, done=%d) unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: unauthenticated request from (%08x:%d) lockd: NULL called lockd: TEST called test: status before %d lockd: TEST status %d vers %d lockd: LOCK called lockd: LOCK status %d lockd: CANCEL called lockd: CANCEL status %d lockd: UNLOCK called lockd: UNLOCK status %d lockd: GRANTED called lockd: GRANTED status %d lockd: TEST_MSG called lockd: LOCK_MSG called lockd: CANCEL_MSG called lockd: UNLOCK_MSG called lockd: GRANTED_MSG called lockd: SHARE called lockd: SHARE status %d lockd: UNSHARE called lockd: UNSHARE status %d lockd: NM_LOCK called lockd: SM_NOTIFY called <4>lockd: rejected NSM callback from %08x:%d lockd: %4d callback failed (errno = %d) unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: nlm_file_lookup(%s/%u) lockd: creating file for %s/%u lockd: open failed (nfserr %d) lockd: found file %p (count %d) lockd: closing file %s/%ld <4>lockd: attempt to release unknown file! lockd: unlock failure in %s:%d svcsubs.clockd: nlm_release_file(%p, ct = %d) lockd: nlmsvc_mark_resources lockd: nlmsvc_free_host_resources <4>lockd: couldn't remove all locks held by %slockd: invalidating client for %s unknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <7>nsm_mon_unmon: rpc failed, status=%d lockd: nsm_monitor(%s) <5>lockd: cannot monitor %s lockd: nsm_unmonitor(%s) <5>lockd: cannot unmonitor %s localhostnsm: xdr_encode_mon(%08x, %d, %d, %d) %d.%d.%d.%dnsm: xdr_decode_stat_res status %d state %d sm_notifysm_simu_crashsm_unmon_allsm_unmonsm_monsm_statsm_nullstatdunknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: bad cookie size %d (only cookies under 8 bytes are supported.) <5>lockd: bad fhandle size %x (should be %d) nlm_undefnlm_granted_resnlm_unlock_resnlm_canc_resnlm_lock_resnlm_test_resnlm_granted_msgnlm_unlock_msgnlm_canc_msgnlm_lock_msgnlm_test_msgnlm_grantednlm_unlocknlm_cancnlm_locknlm_testnlm_nulllockdunknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: bad cookie size %d (only cookies under 8 bytes are supported.) <5>lockd: bad fhandle size %x (should be %d) xdr: before encode_testres (p %p resp %p) xdr: encode_testres (status %d pid %d type %d start %ld end %ld) xdr: after encode_testres (p %p resp %p) nlm4_undefnlm4_granted_resnlm4_unlock_resnlm4_canc_resnlm4_lock_resnlm4_test_resnlm4_granted_msgnlm4_unlock_msgnlm4_canc_msgnlm4_lock_msgnlm4_test_msgnlm4_grantednlm4_unlocknlm4_cancnlm4_locknlm4_testnlm4_nullunknownnone<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%x/%ld) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: unauthenticated request from (%08x:%d) lockd: NULL called lockd: TEST4 called lockd: TEST4 status %d lockd: LOCK called lockd: LOCK status %d lockd: CANCEL called lockd: CANCEL status %d lockd: UNLOCK called lockd: UNLOCK status %d lockd: GRANTED called lockd: GRANTED status %d lockd: TEST_MSG called lockd: LOCK_MSG called lockd: CANCEL_MSG called lockd: UNLOCK_MSG called lockd: GRANTED_MSG called lockd: SHARE called lockd: SHARE status %d lockd: UNSHARE called lockd: UNSHARE status %d lockd: NM_LOCK called lockd: SM_NOTIFY called <4>lockd: rejected NSM callback from %08x:%d lockd: %4d callback failed (errno = %d) Unable to load NLS charset %s: name too long nls_%sUnable to load NLS charset %s defaultcp437ufs_free_fragmentsinternal errorfreeing blocks are outside deviceinternal error, bad magic number on cg %ubit already cleared for fragment %uufs_free_blocksinternal error, fragment %u, count %u freeing free fragmentufs_new_fragmentsinternal warning fragment %u, count %uinternal error, fragment %u, tmp %u <3>ufs_new_fragments: bread fail ufs_add_fragmentsinternal error or corrupted bitmap on cg %uufs_alloc_fragmentsufs_bitmap_searchbitmap corrupted on cg %u, start %u, length %u, count %u, freeoff %u block not in map on cg %u ufs_read_cylindercan't read cylinder group block %uufs_put_cylinderinternal errorufs_load_cylinderinternal error, high number of cginternal error, wrong number of cg in cacheufs_readdir: dir inode %lu has a hole at offset %lu ufs_readdirreclen is smaller than minimalreclen % 4 != 0reclen is too small for namlendirectory entry across blocksinode out of boundsbad entry in directory #%lu, size %lu: %s - offset=%lu, inode=%lu, reclen=%d, namlen=%dufs_file_writemode = %07oufs_free_inodeinode has count=%d inode has nlink=%d reserved inode or nonexistent inode %u ufs_free_fragmentsinternal error, bad cg magic numberbit already cleared for inode %uufs_new_inodecylinder group %u corrupted - error in inode bitmap internal errorufs_bmapblock > bigufs_getblkufs_read_inodebad inode number (%lu) unable to read inode %lu inode %lu has zero nlink ufs_find_entrydirectory #%lu contains a hole at offset %luufs_add_entryinternal error fragoff %uufs_delete_entry...empty_dirbad directory (dir #%lu) - no data blockbad directory (dir #%lu) - no `.' or `..'ufs_rmdirempty directory has nlink!=2 (%d)ufs_unlinkDeleting nonexistent file (%lu), %dUFS-fs panic (device %s): %s: %s <2>UFS-fs error (device %s): %s: %s <2>UFS-fs panic (device %s): %s: %s <4>UFS-fs warning (device %s): %s: %s ,ufstypeoldsun44bsdnextstepnextstep-cdopenstepsunx86UFS-fs: Invalid type option: %s onerrorpaniclockumountrepairUFS-fs: Unable to do repair on error, will lock lock instead UFS-fs: Invalid action onerror: %s UFS-fs: Invalid option: %s wrong mount options You didn't specify the type of your ufs filesystem mount -t ufs -o ufstype=sun|sunx86|44bsd|old|nextstep|netxstep-cd|openstep ... >>>WARNING<<< Wrong ufstype may corrupt your filesystem, default is ufstype=old <6>ufstype=old is supported read-only <6>ufstype=nextstep is supported read-only <6>ufstype=nextstep-cd is supported read-only <6>ufstype=openstep is supported read-only unknown ufstype ufs_read_super: bad magic number ufs_read_super: fs_bsize %u != {4096, 8192} ufs_read_super: fs_fsize %u != {512, 1024, 2048} ufs_read_super: fs is active ufs_read_super: fs is bad ufs_read_super: can't grok fs_clean 0x%x ufs_read_super: fs needs fsck ufstype can't be changed during remount this ufstype is read-only supported failed during remounting ufsufs_trunc_directinternal errorufs_truncate_direct...%ddevpts_put_super: badness: entry %d count %d ,uidgidmodedevpts: called with bogus options devpts: get root dentry failed devpts<3>socki_lookup: socket file changed! <3>sock_release: fasync list not empty! <7>sock_close: NULL inode net-pf-%d<4>socket: no more sockets <2>protocol %d >= NPROTO(%d) <6>Linux NET4.0 for Linux 2.2 <6>Based upon Swansea University Computer Society NET3.039 sockets: used %d INETSNAP802.2UNIXPACKETNETLINK<7>sk_free: optmem leakage (%d bytes) detected. sockskput:over: %p:%d put:%d dev:%sskput:under: %p:%d put:%d dev:%sNetworking buffers in use : %u Total network buffer allocations : %u Total failed network buffer allocs : %u IP fragment buffer size : %u <3>alloc_skb called nonatomically from interrupt %p <4>Warning: kfree_skb passed an skb still on a list (from %p). skbuff_head_cachecannot create skbuff cacheoptmem_maxmessage_burstmessage_costnetdev_max_backlogrmem_defaultwmem_defaultrmem_maxwmem_max100baseFX100baseTX100baseTAUI10baseTBNCunknown<4>dev_remove_pack: %p not found. <7>%s: default_rebuild_header called -- BUG! NULL!!!dev_close: bug %s still running <7>protocol %04x is buggy, dev %s <7>BUG: packet without dst looped back 1 <7>Virtual device %s asks to queue packet! <2>%s: wrong mac.raw ptr, proto=%04x %6s:%8lu %7lu %4lu %4lu %4lu %5lu %10lu %9lu %8lu %7lu %4lu %4lu %4lu %5lu %7lu %10lu %6s: No statistics available. Inter-| Receive | Transmit face |bytes packets errs drop fifo frame compressed multicast|bytes packets errs drop fifo colls carrier compressed %08x %08x %08x %08x %08x <6>device %s %s promiscuous mode enteredleft<6>early initialization of device %s is deferred devnet/dev_statdev_mc_discard: multicast leakage! dmi_users=%d %-4d %-15s %-5d %-5d %02x net/dev_mcastneigh_ifdown: impossible event 1763 neigh_destroy: neighbour is use tbl=%p, ref=%d: called from %p neigh: timer & !nud_in_timer neigh_resolve_output: dst=%p neigh=%p neigh_release_parms: not found <2>neighbour leakage netneighdefaultgc_thresh3gc_thresh2gc_thresh1gc_intervallocktimeproxy_delayanycast_delayproxy_qlenunres_qlengc_stale_timedelay_first_probe_timebase_reachable_timeretrans_timeapp_solicitucast_solicitmcast_solicit<4>NET: %d messages suppressed. <7>%s: unable to resolve type %X addresses. EtherII<7>%s deferred output. It is buggy. <6>%s: activation failed Assertion (dev->qdisc_list == NULL) failed at sch_generic.c(%d):dev_shutdown 802.2SNAP - unable to register with 802.2 SNAP802.3<3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%dBUG!LISTENLAST_ACKCLOSE_WAITCLOSETIME_WAITFIN_WAITSYN_RECVSYN_SENTESTABLISHEDNONEERR!<3>IP_MASQ:ip_masq_hash(): request for already hashed, called from %p <3>IP_MASQ:ip_masq_unhash(): request for unhash flagged, called from %p <3>IP_MASQ:ip_masq_new(proto=%s): no free ports. <3>IP_MASQ:ip_masq_new(proto=%s): no memory available. <3>IP_MASQ:Already used connection: %s, %d.%d.%d.%d:%d => %d.%d.%d.%d:%d, called from %p <3>IP_MASQ:ip_masq_new(proto=%s): could not get free masq entry (free=%d). <6>IP_MASQ:ip_fw_masquerade(): change masq.addr from %d.%d.%d.%d to %d.%d.%d.%d <6>IP_MASQ:ip_fw_masq_icmp(): change masq.addr %d.%d.%d.%d to %d.%d.%d.%d<3>IP_MASQ:reverse ICMP: failed checksum from %d.%d.%d.%d! <3>IP_MASQ:request control ADD for already controlled: %d.%d.%d.%d:%d to %d.%d.%d.%d:%d <3>IP_MASQ:request control DEL for uncontrolled: %d.%d.%d.%d:%d to %d.%d.%d.%d:%d <3>IP_MASQ:BUG control DEL with n=0 : %d.%d.%d.%d:%d to %d.%d.%d.%d:%d Prc FromIP FPrt ToIP TPrt Masq Init-seq Delta PDelta Expires (free=%d,%d,%d)%-127s %s %08X:%04X %08X:%04X %04X %08X %6d %6d %7luip_masq_usernet/ip_masq<3>IP_MASQ:Could not create "/proc/net/ip_masq" entry ip_masquerade 2Ё$h tcp3($h  udp3p$h  icmp3$h  <3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%d<3>IP_MASQ:unregister_ip_masq_app(): NULL arg <3>IP_MASQ:unregister_ip_masq_app(): has %d attachments. failed <3>IP_MASQ:unregister_ip_masq_app(flags=0x%x, proto=%s,port=%u,fwmark=%d): not hashed! <3>IP_MASQ:ip_masq_app: tried to set n_attach < 0 for (proto=%s,port==%d) ip_masq_app object. <3>IP_MASQ:ip_masq_bind_app() called for already bound object. %-39s prot port n_attach name%-3s %-7u %-7d %-17s app<3>IP_MASQ:skb_replace(): no room left (from %p) %d.%d.%d.%d%-127s Iface Destination Gateway Flags RefCnt Use Metric Source MTU Window IRTT TOS HHRef HHUptod SpecDst%s %08lX %08lX %8X %d %u %d %08lX %d %u %u %02X %d %1d %08X*dst cache overflow neighbour table overflow <7>ip_rt_bug: %08x -> %08x, %s ?<2>Bug in ip_route_input_slow(). Please, report mtu_expiresgc_elasticityerror_bursterror_costredirect_silenceredirect_numberredirect_loadgc_intervalgc_timeoutgc_min_intervalmax_sizegc_threshmax_delaymin_delayflushrt_cache8$h %4d: %08lX:%04X %08lX:%04X %02X %08X:%08X %02X:%08lX %08X %5d %8d %u%4d: %08lX:%04X %08lX:%04X %02X %08X:%08X %02X:%08lX %08X %5d %8d %lu%-127s sl local_address rem_address st tx_queue rx_queue tr tm->when retrnsmt uid timeout inodeTCP: inuse %d highest %d UDP: inuse %d highest %d RAW: inuse %d highest %d Ip: Forwarding DefaultTTL InReceives InHdrErrors InAddrErrors ForwDatagrams InUnknownProtos InDiscards InDelivers OutRequests OutDiscards OutNoRoutes ReasmTimeout ReasmReqds ReasmOKs ReasmFails FragOKs FragFails FragCreates Ip: %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu Icmp: InMsgs InErrors InDestUnreachs InTimeExcds InParmProbs InSrcQuenchs InRedirects InEchos InEchoReps InTimestamps InTimestampReps InAddrMasks InAddrMaskReps OutMsgs OutErrors OutDestUnreachs OutTimeExcds OutParmProbs OutSrcQuenchs OutRedirects OutEchos OutEchoReps OutTimestamps OutTimestampReps OutAddrMasks OutAddrMaskReps Icmp: %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu Tcp: RtoAlgorithm RtoMin RtoMax MaxConn ActiveOpens PassiveOpens AttemptFails EstabResets CurrEstab InSegs OutSegs RetransSegs InErrs OutRsts Tcp: %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu Udp: InDatagrams NoPorts InErrors OutDatagrams Udp: %lu %lu %lu %lu TcpExt: SyncookiesSent SyncookiesRecv SyncookiesFailed EmbryonicRsts PruneCalled RcvPruned OfoPruned OutOfWindowIcmps LockDroppedIcmps SockMallocOOM TcpExt: %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu IpExt: ArpFilter IpExt: %lu <7>non CLOSE socket in time_done net_timer: timer expired - reason %d is unknown IGMPTCPUDPICMP<3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%d<7>ip_input(): demasq recursion detected. Check masq modules configuration <6>source route option %d.%d.%d.%d -> %d.%d.%d.%d ip_evictor: memcount<6>Oversized IP packet from %d.%d.%d.%d. <6>Oversized packet received from %d.%d.%d.%d <3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%d<2>ip_forward(): Argh! Destination lost! igmp<7>tcp_readable: %p - <7>empty <7>got %lu bytes. <6>recvmsg bug: copied %X seq %X tcp_close: socket already locked! tcp_open_requesttcp_init: Cannot alloc open_request cache.tcp_bind_buckettcp_init: Cannot alloc tcp_bind_bucket cache.tcp_tw_buckettcp_init: Cannot alloc tcp_tw_bucket cache.Failed to allocate TCP established hash table Failed to allocate TCP bind hash table TCP: Hash tables configured (ehash %d bhash %d) tcp_parse_options: Illegal window scaling value %d >14 received.<7>Ack ignored %u %u tcp_fin: Impossible, sk->state=%d <7>ofo packet was already received <7>ofo requeuing : rcv_next %X seq %X - %X <7>retransmit received: seq %X <7>partial packet: rcv_next %X seq %X - %X <7>out of order segment: rcv_next %X seq %X - %X <7>*** tcp.c:tcp_data bug acked < copied <7>prune_queue: c=%x <7>seq:%d end:%d wup:%d wnd:%d <7>syn in established state <7>bad ack tcp_select_window: tp->window_clamp == 0. tcp_select_window: sk->mss fell to 0. <7>initial req->mss below 8 <7>tcpbug: unknown timer value <7>bug: tcp_reset_xmit_timer TIME_WRITE <7>bug: unknown timer value tcp_v4_hash: bug, socket state is %d <7>%s forgot to set AF_INET in tcp_v4_connect <6>possible SYN flooding on port %d. Sending cookies. <7>Reset on %p: Connect on dead socket. <4>tcp_v4_rebuild_header(): not valid sock addrs: saddr=%08X rcv_saddr=%08X <6>tcp_v4_rebuild_header(): shifting sk->saddr from %d.%d.%d.%d to %d.%d.%d.%d Failed to create the TCP control socket. <6>%s forgot to set AF_INET in raw sendmsg. Fix it! <4>%s forgot to set AF_INET in udp sendmsg. Fix it! <7>trying to ucast probe in NUD_INVALID <7>ARP: arp called for own IP address <7>arp_find is called with dst==NULL 0123456789ABCDEFIP address HW type Flags HW address Mask Device %-17s0x%-10x0x%-10x%s %-17s %s *00:00:00:00:00:00arpipv4<3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%d<7>icmp_send: destinationless packet <6>ICMP: %d.%d.%d.%d: fragmentation needed and DF set. <6>ICMP: %d.%d.%d.%d: Source Route Failed. <4>%d.%d.%d.%d sent an invalid ICMP error to a broadcast. <6>Wrong address mask %08X from %08X/%s Failed to create the ICMP control socket. ipv4<7>inetdev_event: bug netconfallarp_filterhiddenlog_martiansbootp_relayproxy_arpaccept_source_routesend_redirectsrp_filtershared_mediasecure_redirectsaccept_redirectsmc_forwardingforwardingdefault<3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%d<6>%s uses obsolete (PF_INET,SOCK_PACKET) rarprawnetstatsnmpsockstattcpudp<6>NET4: Linux TCP/IP 1.0 for NET4.0 <2>inet_proto_init: panic <6>IP Protocols: %s%s, Idx Device : Count Querier Group Users Timer Reporter NONEV1V2%d %-10s: %5d %7s %08lX %5d %d:%08lX %d igmp_max_membershipsrouteicmp_echoreply_rateicmp_paramprob_rateicmp_timeexceed_rateicmp_destunreach_rateicmp_ignore_bogus_error_responsesicmp_echo_ignore_broadcastsicmp_echo_ignore_allip_local_port_rangetcp_max_syn_backlogtcp_rfc1337tcp_stdurgtcp_fin_timeouttcp_retries2tcp_retries1tcp_keepalive_probestcp_keepalive_timetcp_max_ka_probesipfrag_timeip_masq_udp_dlooseip_masq_debugip_always_defragip_dynaddripfrag_low_threshipfrag_high_threshtcp_syn_retriesip_no_pmtu_discip_autoconfigip_default_ttlip_forwardtcp_retrans_collapsetcp_sacktcp_window_scalingtcp_timestamps%-127s Iface Destination Gateway Flags RefCnt Use Metric Mask MTU Window IRTT<7>fib_add_ifaddr: bug: prim == NULL <7>fib_del_ifaddr: bug: prim == NULL routeRP$h H<7>impossible 102 %s %08X %08X %04X %d %u %d %08X %d %u %u** %08X %08X %04X %d %u %d %08X %d %u %u<3>IP_MASQ:ip_masq_app_init_fwmark(): fwmark must be <= %d, sorry (shoot Juanjo) ICMPTCPUDPIP_%dDENYACCEPTREJECTREDIRECTMASQ-RETURNUNKNOWN<6>Packet log: %s %s %d %s PROTO=%d %d.%d.%d.%d:%hu %d.%d.%d.%d:%hu L=%hu S=0x%2.2hX I=%hu F=0x%4.4hX T=%hu O=0x%8.8X %s(#%d) SYN <3>Chain backtrace: %s<-%s Suspect TCP fragment. Suspect short first fragment. <3>IP firewall: Loop detected at `%s'. Can't kmalloc for firewall chains. %9s %08X/%08X->%08X/%08X %.16s %X %X %u %-9u %-9u %-9u %-9u %u-%u %u-%u A%02X X%02X %08X %u %u %9s %s %s %i %u %u %u %u ip_fwchainsip_fwnamesinputforwardoutputUnable to register IP firewall. tunl0dvmrp%dpimreg<4>mroute: pending queue full, dropping entries. Interface BytesIn PktsIn BytesOut PktsOut Flags Local Remote none%2d %-10s %8ld %7ld %8ld %7ld %05X %08X %08X Group Origin Iif Pkts Bytes Wrong Oifs %08lX %08lX %-3d %8ld %8ld %8ld %2d:%-3d ip_mr_vifip_mr_cache<6>Linux IP multicast router 0.06 plus PIM-SM dummy<4>DHCP/BOOTP: Ignoring device %s, MTU %d too small<3>IP-Config: Can't open %s <3>IP-Config: No such device: %s <3>IP-Config: No network devices available <3>IP-Config: Can't set interface address: Error %d <3>IP-Config: Can't set netmask: Error %d <3>IP-Config: Can't set broadcast address: Error %d <3>IP-Config: Gateway not on directly connected network <3>IP-Config: Can't add default route: Error %d <3>IP-Config: Can't guess netmask for %s IP-Config: Guessing netmask: %s #PROTO: %s DHCPBOOTPRARP#MANUAL domain %s nameserver %s pnpZ($h K|<3>IP-Config: Not enough information IP-Config: Complete: if=%s, addr=%s, mask=%s, gw=%s, host=%s, domain=%s, nis-domain=%s, bootserver=%s, rootserver=%s, rootpath=%s onanyoffnone%08xNum RefCount Protocol Flags Type St Inode Path %p: %08X %08X %08lX %04X %02X %5ld<6>NET4: Unix domain sockets 1.0 for Linux NET4.0. <2>unix_proto_init: panic net/unixmax_dgram_qlendelete_delaydestroy_delay<7>netlink_release: impossible event. Please, report. sk Eth Pid Groups Rmem Wmem Dump Locks %p %-3d %-6d %08x %-8d %-8d %p %d<2>netlink_proto_init: panic net/netlinkunknownnoneunknownnoneRPC: creating %s client for %s (xprt %p) bindwait<6>RPC: out of memory in rpc_create_client <6>RPC: Couldn't create auth handle (flavor %d) RPC: shutting down %s client for %s RPC: rpc_shutdown_client: client %s, tasks=%d RPC: destroying %s client for %s RPC: rpc_release_client(%p, %d) rpc_call_sync: Illegal flag combination for synchronous task <4>%s (vers %d): bad procedure number %d RPC: %4d call_reserve RPC: %4d call_reserveresult (status %d) call_reserveresult: status=%d, request=%p?? RPC: task timed out <6>RPC: task has no request, exit EIO RPC: %4d call_allocate (status %d) <6>RPC: buffer allocation failed for task %p RPC: %4d call_encode (status %d) <6>RPC: call_header failed, exit EIO <4>%s: can't encode arguments: %d RPC: %4d call_reconnect status %d RPC: %4d call_transmit (status %d) RPC: %4d call_status (status %d) %s: RPC call returned error %d RPC: %4d call_timeout (minor timeo) <5>%s: task %d can't get a request slot RPC: %4d call_timeout (major timeo) <5>%s: server %s not responding, timed out RPC: %4d call_decode (status %d) <4>%s: too small RPC reply size (%d bytes) RPC: %4d retry squashed uid RPC: %4d call_decode result %d RPC: %4d call_refresh RPC: %4d call_refreshresult (status %d) <4>call_verify: not an RPC reply: %x <4>call_verify: RPC call rejected: %x RPC: %4d call_verify: retry stale creds RPC: %4d call_verify: retry garbled creds <5>call_verify: server requires stronger authentication. <4>call_verify: unknown auth error: %x RPC: %4d call_verify: call rejected %d <4>call_verify: auth check failed <4>call_verify: server accept status: %x RPC: %4d call_verify: server saw garbage <4>RPC: garbage, retrying %4d <4>RPC: garbage, exit EIO unknownnonepacket data:RPC: xprt_sendmsg(%d) = %d <5>RPC: sendmsg returned error %d RPC: xprt_recvmsg(iov %p, len %d) = %d RPC: cong %08lx, cwnd was %08lx, now %08lx, time %ld ms RPC: cong %ld, cwnd was %ld, now %ld, time %ld ms <4>xprt_adjust_timeout: to_current = 0! RPC: disconnected transport %p RPC: %4d xprt_reconnect %p connected %d RPC: %4d connecting new socket RPC: TCP connect error %d! RPC: %4d connect status %d connected %d xprt_lookup_rqst: loop in Q! RPC: unknown XID %08x in reply. RPC: %4d has input (%d bytes) RPC: udp_data_ready... RPC: udp_data_ready request not found! RPC: udp_data_ready client %p RPC: impossible RPC reply size %d! RPC: %4d received reply, (%d bytes) RPC: reading header (%d bytes) RPC: New record reclen %d morefrags %d RPC: reading xid (%d bytes) RPC: %4d TCP receiving %d bytes RPC: %4d received reply complete RPC: TCP skipping %d bytes RPC: tcp_input_record RPC: tcp_input_record done (off %d reclen %d copied %d) RPC: xprt queue %p rpciod_tcp_dispatcher: Queue Running rpciod_tcp_dispatcher: Processing %p RPC: tcp_data_ready... Not a socket with xprt %p RPC: tcp_data_ready client %p RPC: state %x conn %d dead %d zapped %d RPC: tcp_state_change client %p... RPC: %4d xprt_timer (%s request) pendingbackloggedRPC: %4d TCP write queue full (task %d) RPC: %4d xprt_transmit(%x) RPC: %4d xmit incomplete (%d left of %d) RPC: %4d xmit complete RPC: %4d xprt_receive RPC: %4d xprt_reserve cong = %ld cwnd = %ld RPC: xprt_reserve waiting on backlog RPC: %4d xprt_reserve returns %d RPC: %4d reserved req %p xid %08x RPC: %4d release request %p RPC: %4d xprt_ping_reserve cong = %ld cwnd = %ld RPC: %4d xprt_ping_reserve returns %d doh, NFS bugRPC: setting up %s transport... UDPTCPxprt_pendingxprt_sendingxprt_backlogxprt_reconnxprt_pingwaitRPC: created transport %p RPC: Can't bind to reserved port (%d). RPC: xprt_create_socket(%s %d) udptcpRPC: can't create socket (%d). RPC: xprt_create_proto called RPC: destroying transport %p unknownnoneschedqchildqdelayqRPC: %4d disabling timer RPC: %4d running timer RPC: %4d setting alarm for %lu ms RPC: %4d deleting timer <4>RPC: task already queued! task already on %s, to be added to %s RPC: %4d added to queue %p "%s" RPC: %4d removed from queue %p "%s" <3>RPC: task w/ running timer in rpc_make_runnable!! <4>RPC: failed to add task to queue: error: %d! <3>rpciod: wot no daemon? RPC: %4d sleep_on(queue "%s" time %ld) <3>RPC: Inactive synchronous task put to sleep! RPC: %4d __rpc_wake_up (now %ld inh %d) <3>RPC: attempt to wake up non-existing task! <3>RPC: Inactive task (%p) being woken up! RPC: __rpc_wake_up done RPC: %4d timeout (default timer) RPC: wake_up_next(%p "%s") RPC: %4d rpc_execute flgs %x <4>RPC: rpc_execute called for sleeping task!! RPC: %4d sync task going to sleep <3>RPC: rpciod waiting on sync task %4d! RPC: %4d sync task resuming RPC: %4d got signal RPC: %4d exit() = %d <3>RPC: dead task tries to walk away. <6>RPC: execution inhibited! <3>RPC: active task was run twice! RPC: rpc_schedule enter <3>RPC: Locked task was scheduled !!!! RPC: rpc_schedule leave RPC: allocated buffer %p RPC: used last-ditch swap buffer RPC: %d new task procpid %d%s (alloc)rpc_new_task: failed, users=%d, oneshot=%d RPC: %4d release task <3>RPC: attempt to release a non-existing task! RPC: %4d freeing task RPC: killing all tasks for client %p rpciodRPC: rpciod starting (pid %d) RPC: rpciod back to sleep RPC: switch to rpciod RPC: rpciod shutdown commences <3>rpciod: active tasks at shutdown?! RPC: rpciod exiting rpciod_killall: waiting for tasks to exit rpciod_up: pid %d, users %d <4>rpciod_up: no pid, %d users?? <4>rpciod_up: create thread failed, error=%d rpciod_down pid %d sema %d <4>rpciod_down: pid=%d, no users?? rpciod_down: Nothing to do! rpciod_down: waiting for pid %d to exit rpciod_down: caught signal -pid- proc flgs status -client- -prog- --rqstp- -timeout -rpcwait -action- --exit-- %05d %04d %04x %06d %8p %6d %8p %08ld %8s %8p %8p unknownnoneRPC: gc'ing RPC credentials for auth %p RPC: looking up %s cred RPC: %4d looking up %s cred RPC: matching %s cred %d RPC: %4d holding %s cred %p RPC: %4d releasing %s cred %p RPC: %4d marshaling %s cred %p RPC: %4d validating %s cred %p RPC: %4d refreshing %s cred %p RPC: %4d invalidating %s cred %p unknownnoneRPC: creating NULL authenticator for client %p RPC: destroying NULL authenticator %p RPC: bad verf flavor: %ld RPC: bad verf size: %ld NULLunknownnoneRPC: creating UNIX authenticator for client %p RPC: destroying UNIX authenticator %p RPC: allocating UNIX cred for uid %d gid %d RPC: allocating fake UNIX cred for uid %d gid %d RPC: bad verf flavor: %ld RPC: giant verf size: %ld UNIXunknownnoneRPC: svc_destroy(%s, %d) svc_destroy: no threads for serv=%p! RPC: svc_register(%s, %s, %d) udptcpsvc: failed to encode reply svc: calling dispatcher svc: svc_process dropit svc: short len %d, dropping request svc: bad direction %d, dropping request svc: authentication failed (%d) svc: unknown program %d (me %d) svc: unknown version (%d) svc: unknown procedure (%d) svc: failed to decode args svc: service %p, releasing skb %p <3>svc_sock_enqueue: threads and sockets both waiting?? svc: socket %p busy, not enqueued svc: socket %p served by daemon %p <3>svc_sock_enqueue: server %p, rq_sock=%p! svc: socket %p put into queue svc: socket %p dequeued, inuse=%d <5>svc: sk_data negative! svc: socket %p re-enqueued after receive svc: socket %p re-enqueued after accept svc: releasing dead socket svc: daemon %p woken up. svc: socket %p sendto([%p %d... ], %d, %d) = %d svc: socket %p recvfrom(%p, %d) = %d svc: socket %p(inet %p), count=%d, busy=%d svc: recvfrom returned error %d svc: socket %p TCP (listen) state change %d svc: socket %p: no user data svc: socket %p TCP (connected) state change %d (svsk %p) svc: socket %p TCP data ready (svsk %p) svc: tcp_accept %p sock %p <4>%s: no more sockets! svc: tcp_accept %p allocated <4>%s: socket dup failed (err %d)! <4>%s: accept failed (err %d)! <4>%s: peername failed (err %d)! <4>%s: connect from unprivileged port: %u.%u.%u.%u:%d %s: connect from %s:%04x svc: tcp_recv %p data %d conn %d close %d <5>RPC: bad TCP reclen %08lxsvc: TCP record, %d bytes svc: incomplete TCP record (%d of %d) svc_recv: more data at hte socket len %d > svsk->sk_reclen %dsvc: TCP complete record (%d bytes) RPC: TCP recvfrom got EAGAIN <5>%s: recvfrom returned errno %d setting up TCP socket for listening setting up TCP socket for reading svc: server %p waiting for data (to = %ld) <3>svc_recv: service %p, socket not NULL! <3>svc_recv: service %p, wait queue active! svc: server %p, no data yet svc: server %p, socket %p, inuse=%d svc: got len=%d svc: socket %p dropped request <4>NULL socket pointer in %s:%d svcsock.csvc: svc_setup_socket %p <4>svsk->sk_sk == NULL after svc_prot_init! svc: svc_setup_socket created %p (inet %p) svc: svc_create_socket(%s, %d, %08x:%d) <4>svc: only UDP and TCP sockets supported svc: svc_create_socket error = %d svc: svc_delete_socket(%p) <5>svc: server socket destroy delayed (sk_inuse: %d) svc: creating socket proto = %d svc: svc_authenticate (%d) svc: bad null cred svc: bad null verf unknownnoneRPC: %4d rpc_getport(%s, %d, %d, %d) RPC: rpc_getport_external(%s, %d, %d, %d) RPC: %4d pmap_getport_done(status %d, port %d) RPC: registering (%d, %d, %d, %d) with portmapper. localhostRPC: couldn't create pmap client <4>RPC: failed to contact portmap (errno %d). RPC: registration status %d/%d RPC: xdr_encode_mapping(%d, %d, %d, %d) pmap_getpmap_unsetpmap_setpmap_nullportmapunknownnoneRPC: %4d, ping_call_reserve RPC: %4d, ping_call_allocate (status %d) RPC: %4d, ping_call_encode (status %d) RPC: %4d, ping_call_transmit RPC: %4d, ping_call_receive (status %d) <5>%s: server %s OK <5>%s: server %s is not responding <5>%s: server %s still not responding RPC: %4d, ping_call_exit (status %d) RPC: %4d, rpc_ping RPC: %4d, rpc_ping, waiting on completion RPC: %4d, rpc_ping, failed to create child process RPC: %4d, rpc_ping, running child process %4d <7>RPC: Urk! Large shift of short iovec. unknownnone%dnlm_debugnfsd_debugnfs_debugrpc_debugsunrpcunknownnonenet %d %d %d %d rpc %d %d %d proc%d %d %drpc %d %d %d %d %d RPC: registering /proc/net/rpc/%s RPC: registering /proc/net/rpc net/rpcRPC: unregistering /proc/net/rpc ipv4ethernet802unixcoremapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... get_request(%d): impossible! <3>drive_stat_acct: cmd not R/W? elevator_starve_rest_of_queue<6>attempt to access beyond end of device <6>%s: rw=%d, want=%d, limit=%d <6>dev %s blksize=%d blocknr=%ld sector=%ld size=%ld count=%d <3>make_request: bad block dev cmd, must be R/W/RA/WA <3>ll_rw_block: Trying to read nonexistent block-device %s (%ld) <5>ll_rw_block: device %s: only %d-char blocks implemented (%lu) <3>Bad md_map in ll_rw_block <5>Can't write to read-only device %s end_request: I/O error, dev %s (%s), sector %lu end_request: buffer-list destroyed looploop: request list destroyedloop: block not locked<3>unknown loop device command (%d)?!?<3>loop: device %s: getblk(-, %d, %d) returned NULL<3>loop: transfer error block %d <4>loop: cannot create block - no backing file <4>loop: cannot create block - no file ops <4>loop: cannot create block - file not writeable <4>loop: cannot create block - FS write failed: code %d <3>loop_set_fd: NULL inode?!? <3>loop: device has no block access/not implemented <4>lo_ioctl: pseudo-major != %d <4>lo_open: pseudo-major != %d <4>lo_release: pseudo-major != %d <3>lo_release: refcount(%d) <= 0 <4>Unable to get major number %d for loop device <6>loop: registered device at major %d md[dev %s]<3>md: %s: invalid raid superblock magic (%x) on block %u <1>md: out of memory. <3>md: disabled device %s <3>md: superblock inconsistency -- run ckraid <3>md: superblock update time inconsistenty -- using the most recent one <1>md: %s: unsupported raid array version %d.%d.%d <3>md: %s: raid array is not clean -- run ckraid <3>md: %s: unsupported raid level %d md: updating raid superblock on device %s, sb_offset == %u <3>md: getblk failed for device %s md-personality-%dDev %s smaller than %dk, cannot shrink STOP_MD md%x failed : i_count=%d, busy=%d md_add(): zero device size, huh, bailing out. FIXME REGISTER_DEV %s to md%x done Bad md device %d Oops ! md%d not running, giving up ! Got md request, not good...Killing md_thread %d %p %s Aiee. md_thread has 0 tsk downing on %p md_threadmdstatmd_error gets unknown device md_error gets an error for an unknown device Personalities : [%d %s] read_ahead not set %d sectors md%d : %sactivein %s %d blocks maxfault=%ld%s personality registered %s personality unregistered ... resync log .... mddev->nb_dev: %d .... raid array: %s .... max_blocks: %d blocksize: %d md: syncing RAID array %s <1>read error, stopping reconstruction. %03d%% done. .md: %s: sync done. md driver %d.%d.%d MAX_MD_DEV=%d, MAX_REAL=%d Unable to get major %d for md %s/c%dd%d%s/c%dd%dp%dhdsd%c%c%d%s%c%d%s%c %sStrange blocksize for partition table [s%d] >??? unable to read partition table %s: RESETTINGING SECTOR SCALE from %d to 1 <! Dev %s: unable to read partition table Dev %s Sun disklabel: Csum bad, label corrupted Dev %s SGI disklabel: csum bad, label corrupted Dev %s: unable to read RDB block %d Dev %s: RDB in block %d has bad checksum Warning: Trashed word at 0xd0 in block %d ignored in checksum calculation RDSKDev %s: unable to read partition block %d %s: error reading partition table <6>Partition check: <6> %s: unknown partition table major minor #blocks name %4d %4d %10d %s mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutfloppy: Asked to read unknown port %d floppy: Port bolixed.sun_82072_fd_inb: How did I get here?floppy: Asked to write to unknown port %d Can't set AUXIO register on this machine.Unknown dma mode %d floppy: Giving up...floppyobioSUNW,fdtwofdstatusdisabledreg2.88M2.88M AMI BIOS1.44M720k1.2M360K PCunknownH1600D800H1840E3840E3520E3200H1920H1760h1600D1120D1040h880H1743h1494H830h420H1722h1476H820h410H1680h1440E3120E2880H1440h720h360D720D360h1200d360%s dtime=%lu floppy%d: timeout handler died: %s floppy%d: reschedule timeout floppy%d: WARNING disk change called early floppy%d: probing disk change on unselected drive floppy%d: drive=%d fdc=%d dor=%x floppy%d: checking disk change line for drive %d floppy%d: jiffies=%lu floppy%d: disk change line=%x floppy%d: flags=%lx floppy%d: Disk type is undefined after disk change floppy%d: calling disk change from set_dor bad fdc value <3>Trying to lock fdc while usage count=0 lock fdcfloppy%d: FDC access conflict! floppy%d: device interrupt still active at FDC release: %p! floppy%d: calling disk change from watchdog floppy%d: disk removed during i/o zero dma transfer size:%x,non aligned address: %p floppy%d: Getstatus times out (%x) on fdc %d floppy%d: Unable to send byte %x to FDC. Fdc=%x Status=%x floppy%d: get result error. Fdc=%d Last status=%x Read bytes=%d floppy%d: Invalid data rate for perpendicular mode! floppy%d: perpendicular mode not supported by this FDC. : track %d, head %d, sector %d, size %dfloppy%d: -- FDC reply errorfloppy%d: Drive is write protected floppy%d: Over/Underrun - retrying floppy%d: Recalibrate failed!data CRC errorCRC errorsector not foundprobe failed...wrong cylinderbad cylinderunknown error. ST[0..2] are: 0x%x 0x%x 0x%xfloppy%d: Invalid FDC command given! floppy%d: Abnormal termination caused by polling rw_command: seek interrupt:floppy%d: seek failed floppy%d: clearing NEWCHANGE flag because of effective seek floppy%d: checking whether disk is write protected floppy%d: wp=%x floppy%d: calling disk change from seek seek command:recal interrupt:recal interrupt need 1 recal:recal interrupt need 2 recal:floppy%d: clearing NEWCHANGE flag because of second recalibrate recal interrupt default:floppy%d: %s repl[%d]=%x DOR0=%x floppy interrupt on bizarre fdc %d handler=%p bizarre fdcunexpected interruptsenseinormal interrupt endrecalibrate floppy:reset interrupt:reset set in interrupt, calling %p floppy driver state ------------------- now=%lu last interrupt=%lu diff=%lu last called handler=%p timeout_message=%s last output bytes: %2x %2x %lu last result at %lu last redo_fd_request at %lu %2x status=%x fdc_busy=%d DEVICE_INTR=%p floppy_tq.routine=%p fd_timer.function=%p timer_table=%p expires=%lu now=%lu cont=%p CURRENT=%p command_status=%d floppy%d: floppy timeout called no cont in shutdown! floppy shutdownfloppy%d: calling disk change from floppy_ready floppy startfloppy%d: setting NEWCHANGE in floppy_start do wakeupwait_til_donequeue format requestrequest done %dfloppy%d: request list destroyed in floppy request done floppy%d: long rw: %x instead of %lx rs=%d s=%d rh=%d h=%d rt=%d t=%d heads=%d eoc=%d spt=%d st=%d ss=%d in_sector_offset=%d floppy%d: Auto-detected floppy type %s in fd%d floppy%d: in copy buffer current_count_sectors=%ld remaining=%d CURRENT->nr_sectors=%ld CURRENT->current_nr_sectors=%ld max_sector=%d ssize=%d floppy%d: buffer overrun in copy buffer %d sector_t=%d buffer_min=%d read write floppy%d: %p buffer not aligned floppy%d: bh=null in copy buffer after copy floppy%d: weirdness: remaining %d too many sectors %d > %d floppy%d: make_raw_rw_request: unknown command floppy%d: zero dma transfer attempted from make_raw_request floppy%d: indirect=%d direct=%d sector_t=%dfloppy%d: internal error offset !=0 on write floppy%d: fractionary current count b=%lx s=%lx addr=%d, length=%ld st=%d ast=%d mse=%d msi=%d ssize=%x SIZECODE=%d command=%x SECTOR=%d HEAD=%d, TRACK=%d buffer drive=%d buffer track=%d buffer_min=%d buffer_max=%d floppy%d: buffer overrun in schedule dma sector_t=%d buffer_min=%d current_count=%ld floppy%d: buffer overrun in direct transfer floppy%d: more sectors than bytes bytes=%ld sectors=%ld floppy: request list destroyedfloppy: block not lockedredo fd requestfloppy%d: disk absent or changed during operation floppy%d: no autodetectable formats queue fd requestwarning: usage count=0, CURRENT=%p exiting sect=%ld cmd=%d do fd request, old request runningdo fd requestfloppy%d: setting NEWCHANGE in poll_drive weird, reset interrupt called (null)floppy%d: calling disk change from raw_cmd ioctl user formatioctl not yet supported floppy%d: obsolete eject ioctl floppy%d: please use floppycontrol --eject unknown type %d (usb?),<6>Floppy drive(s):%s fd%d is %sfloppy%d: floppy_release with fd_ref == 0floppy%d: Weird, open called with filp=0 floppy%d: Unable to allocate DMA memory floppy%d: check_floppy_change: not a floppy <6>FDC %d is an 8272A FDC %d init: DUMPREGS: unexpected return of %d bytes. <6>FDC %d is an 82072 <6>FDC %d is an 82072A <6>FDC %d is a pre-1991 82077 FDC %d init: UNLOCK: unexpected return of %d bytes. FDC %d init: PARTID: unexpected return of %d bytes. <6>FDC %d is a post-1991 82077 <6>FDC %d is an 82078. <6>FDC %d is a 44pin 82078 <6>FDC %d is a S82078B <6>FDC %d is a National Semiconductor PC87306 <6>FDC %d init: 82078 variant with unknown PARTID=%d. floppy%d: %s flag 0x%x SettingClearingfloppy%d: Assuming %s floppy hardware standardbrokenfloppy%d: wrong number of parameters for CMOS floppy%d: bad drive for set_cmos floppy%d: setting CMOS code to %d L40SXno_unexpected_interruptsunexpected_interruptsslowcmosusefifonofifofifo_depthyesdmaomnibooknodmadebugsilent_dcl_clearmessagesbroken_dclthinkpadone_fdctwo_fdcdaringdmairqasus_pciall_drivesallowed_drive_maskfloppy%d: %s=%d floppy%d: unknown floppy option [%s] floppy%d: allowed options are: %sfloppy%d: botched floppy option floppy%d: Read linux/drivers/block/README.fd Unable to get major %d for floppy floppy initfloppy%d: no floppy controllers found floppy%d: Unable to grab IRQ%d for the floppy driver floppy%d: Unable to grab DMA%d for the floppy driver floppy%d: Floppy io-port 0x%04lx in use floppy timer still active:%s auxiliary floppy timer still active task queue still active ramdiskramdisk: request list destroyedramdisk: block not locked<6>RAMDISK: bad command: %d RAMDISK: Could not get major %dRAM disk driver initialized: %d RAM disks of %dK size <5>RAMDISK: Compressed image found at block %d <5>RAMDISK: romfs filesystem found at block %d <5>RAMDISK: Minix filesystem found at block %d <5>RAMDISK: ext2 filesystem found at block %d <5>RAMDISK: Couldn't find valid RAM disk image starting at %d. RAMDISK: image too big! (%d/%ld blocks) <3>RAMDISK: could not allocate buffer <3>RAMDISK: could not determine device size <5>RAMDISK: Loading %d blocks [%d disk%s] into ram disk... sdone disk #%d. Please insert disk #%d and press ENTER Error opening disk. Loading disk #%d... %cdone. <5>VFS: Insert root floppy disk to be loaded into RAM disk and press ENTER incomplete literal tree incomplete distance tree bad gzip magic numbersinternal error, invalid methodInput is encrypted Multi part input Input has invalid flags invalid compressed format (err=1)invalid compressed format (err=2)out of memoryinvalid compressed format (other)crc errorlength error<3>%s<3>RAMDISK: Couldn't allocate gzip buffer <3>RAMDISK: Couldn't allocate gzip window master pty_close: count = %d!! pty_ioctl called with NULL tty! pty_unix98_ioctl called with NULL tty! pty_masterptypty_slavettypCouldn't register pty driverCouldn't register pty slave driverpty: %d Unix98 ptys configured ptmptsCouldn't register Unix98 ptm driver major %dCouldn't register Unix98 pts driver major %dhead%3i %s char-major-%d-%dmiscunable to get major %d for misc devices mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... redraw_screen: tty %d not allocated ?? [%d;%dR[?6c%c%c%ccon_write: tty %d not allocated vt_console_print: tty %d not allocated ?? ttyCouldn't register console driver Console: %s %s %dx%dcolourmono Console: switching consoles %d-%d to %s %s %dx%d to %s unblank_screen: tty %d not allocated ?? <4>selection: kmalloc() failed <6>SysRq: Keyboard mode set to XLATE SAK Resetting Power off Emergency Sync Emergency Remount R/O Show Regs Show State Show Memory Log level set to %d Terminate All Tasks Kill All Tasks Kill ALL Tasks (even init) unRaw saK Boot Off Sync Unmount showPc showTasks showMem loglevel0-8 tErm kIll killalL <6>%sing device %s ... RemountSyncSuperblock not found R/O error %d OK nothing to do <6>Done. %s%dNULL ttyWarning: bad magic number for tty struct (%s) in %s Warning: null TTY for (%s) in %s Warning: dev (%s) tty->count(%d) != #fd's(%d) in %s tty-ldisc-%dCouldn't open N_TTY ldisc for %s --- error %d.tty_check_change: tty->pgrp <= 0! do_tty_hangupdo_tty_hangup: N_TTY open: error %d tty_readtty_writeinit_dev: ldisc open failed, clearing slot %d release_devrelease_dev: bad idx when trying to free (%s) release_dev: driver.table[%d] not tty for (%s) release_dev: driver.termios[%d] not termios for (%s) release_dev: driver.termios_locked[%d] not termios_locked for (%s) release_dev: other->table[%d] not o_tty for (%s) release_dev: other->termios[%d] not o_termios for (%s) release_dev: other->termios_locked[%d] not o_termios_locked for (%s) release_dev: bad pty pointers release_dev: %s: read/write wait queue active! release_dev: bad pty slave count (%d) for %s release_dev: bad tty->count (%d) for %s tty_open<4>tty_io.c: process %d (%s) used obsolete /dev/%s - update software to use /dev/ttyS%d tty_polltty_fasynctty_ioctlUse of setserial/setrocket to set SPD_* flags is deprecated size of tty structure > PAGE_SIZE!/dev/ttyCouldn't register /dev/tty driver /dev/consoleCouldn't register /dev/console driver /dev/ptmxCouldn't register /dev/ptmx driver /dev/tty0Couldn't register /dev/tty0 driver %s: %d input overrun(s) %s: unknown flag %d n_tty_read_chan: called with read_buf == NULL?!? read_chan: tty->pgrp <= 0! n_ttymapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... Warning?!? termios_locked is NULL. <3>%s: irq%d happened with irq_func NULL with %s as cad! mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... memunable to get major %d for memory devs mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... ;n vAMaX ֣d° xmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... vcsunable to get major %d for vcs devicemapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... eth7eth6eth5eth4eth3eth2eth1eth0loeth%dethether_setup: Ouch! Someone else took %s mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... <7>loopback fed NULL data - splat sunlance.c:v1.12 11/Mar/99 Miguel de Icaza (miguel@nuclecu.unam.mx) LANCELANCE DMAmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutTX rings: %d: 0x%8.8x RX rings: RX ptr: %8.8x TX ptr: %8.8x <3>LANCE unopened after %d ticks, csr0=%4.4x. dcsr=%8.8x <6>%s: Memory squeeze, deferring packet. <5>%s: Carrier Lost, trying %s TPEAUI<3>%s: Tx: ERR_BUF|ERR_UFL, restarting <3>%s: again<3>%s: Memory error, status %04x, addr %06lx <3>Lance: Can't get irq %s <5>resetting ledma <3>%s: transmit timed out, status %04x, reset <6>%s<6>%s: LANCE %2.2x%c lebufferbusmaster-regvalburst-sizescable-selection<6>%s: using auto-carrier-detection. optionstpe-link-test?true<5>%s: warning: overriding option 'tpe-link-test?' <5>%s: warning: mail any problems to ecd@skynet.be Can't set AUXIO register on this machine.aui<3>%s: ERROR: Rx and Tx rings not on even boundary. leledmasunhme.c:v1.10 27/Jan/99 David S. Miller (davem@caipfs.rutgers.edu) mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeout<3>happy meal: Aieee, transceiver MIF read bolixed <3>happy meal: Aieee, transceiver MIF write bolixed <6>%s: Link is up using external internal transceiver at 100Mb/s, Full Duplex. 100Mb/s, Half Duplex. 10Mb/s, Full Duplex. 10Mb/s, Half Duplex. <6>%s: Link has been forced up using 100Mb/s, 10Mb/s, Full Duplex. Half Duplex. <5>%s: Auto-Negotiation unsuccessful, trying force link mode <5>%s: Auto negotiation successful, link still not completely up. <5>%s: Link down, cable problem? <3>%s: Error, cannot re-init the Happy Meal. <3>%s: Aieee, link timer is asleep but we got one anyways! <3>happy meal: Transceiver BigMac ATTACK!<3>happy meal: Receiver BigMac ATTACK!<3>happy meal: Fry guys.<3>happy meal: Transceiver and a coke please.<3>%s: Happy Meal would not start auto negotiation BMCR=0x%04x <5>%s: Performing force link detection. <3>happy meal: Eieee, rx config register gets greasy fries. <3>happy meal: Trying to set %08x, reread gives %08lx <3>%s: Error interrupt for happy meal, status = %08lx <3>%s: Happy Meal receive FIFO overflow. <3>%s: Happy Meal BigMAC SQE test failed. <3>%s: Happy Meal transmitter FIFO underrun, DMA error. <3>%s: Happy Meal MAX Packet size error. <6>%s: Happy Meal out of receive descriptors, packet dropped. <3>%s: Happy Meal rx DMA errors [ GenericError ParityError RxTagBotch ] <3>%s: EOP not set in happy meal transmit descriptor! <3>%s: Happy Meal MIF interrupt. <3>%s: Happy Meal tx DMA errors [ LateError ParityErro TagBotch <3>%s: Happy Meal register access SBUS slave (%s) error. paritygeneric<5>%s: Resetting... <6>%s: Link status change. <6>%s: Switching to 100Mbps at full duplex.<6>%s: Switching to 100MBps at half duplex.<6>%s: Switching to 10MBps at full duplex.<6>%s: Using 10Mbps at half duplex.<6>%s: Memory squeeze, deferring packet. HAPPY MEAL<3>happy meal: Can't order irq %d to go. <3>happy_meal(SBUS): Can't order irq %s to go. <3>%s: transmit timed out, resetting <3>%s: Happy Status %08x TX[%08x:%08x] <3>happy meal: Transmitter access conflict. rangesQuattro<3>Quattro: Fatal IRQ registery error %d. QFE request irq<6>%s<6>%s: Quattro HME slot %d (SBUS) 10/100baseT Ethernet <6>%s: HAPPY MEAL (SBUS) 10/100baseT Ethernet local-mac-address%2.2x%c <3>happymeal: Device does not have 5 regs, it has %d. <3>happymeal: Would you like that for here or to go? Happy Meal Global Regs<3>happymeal: Cannot map Happy Meal global registers. Happy Meal MAC TX Regs<3>happymeal: Cannot map Happy Meal MAC Transmit registers. Happy Meal MAC RX Regs<3>happymeal: Cannot map Happy Meal MAC Receive registers. Happy Meal BIGMAC Regs<3>happymeal: Cannot map Happy Meal BIGMAC registers. Happy Meal Tranceiver Regs<3>happymeal: Cannot map Happy Meal Tranceiver registers. hm-revburst-sizesHappy Meal Init BlockHappy Meal BufsSUNW,hmemodelSUNW,sbus-qfeqfeSUNW,qfesunqe.c:v2.0 9/9/99 David S. Miller (davem@redhat.com) mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeout<3>QuadEther: AIEEE cannot reset the QEC! <3>QuadEther: AIEEE cannot reset the MACE! <3>QuadEther: Cannot reset QE channel! <5>%s: Warning, link state is down. <3>%s: Excessive transmit defers. <3>%s: Carrier lost, link down? <3>%s: Excessive transmit retries (more than 16). <3>%s: Late transmit collision. <3>%s: Transmit fifo underflow, driver bug. <3>%s: Jabber error. <3>%s: Babble error. <3>%s: Transmit descriptor is bogus, driver bug. <3>%s: Transmit late error. <3>%s: Transmit DMA parity error. <3>%s: Transmit DMA sbus error ack. <3>%s: Receive fifo overflow. <3>%s: Late receive collision. <6>%s: Receive packet dropped. <3>%s: Receive buffer too small, driver bug. <3>%s: Receive late error. <3>%s: Receive DMA parity error. <3>%s: Receive DMA sbus error ack. <6>%s: Memory squeeze, deferring packet. <5>%s: transmit timed out, resetting <6>%schannel#ranges<3>QuadEther: Aieee, bogus QEC range for space %08x QEC Global Registers<3>QuadEther: Cannot map QEC global registers. <3>QuadEther: AIEEE, QEC is not in MACE mode! burst-sizesQEC Per-Channel Registers<3>QuadEther: Cannot map QE %d's channel registers. QE MACE Registers<3>QuadEther: Cannot map QE %d's MACE registers. QE Init BlockQE RX/TX BuffersQuadEther<3>QuadEther: Can't register QEC master irq handler. <6>%s: QuadEthernet channel[%d] %2.2x%c qecqesunbmac.c:v1.1 8/Dec/98 David S. Miller (davem@caipfs.rutgers.edu) mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeout<3>BigMAC: Cannot reset the QEC. <3>BIGMAC: Transmitter will not reset. <3>BIGMAC: tx_cfg is %08x <3>BIGMAC: Receiver will not reset. <3>BIGMAC: rx_cfg is %08x <3>write_tcvr_bit: No transceiver type known! <3>read_tcvr_bit: No transceiver type known! <3>read_tcvr_bit2: No transceiver type known! <3>bigmac_tcvr_read: Whoops, no known transceiver type. <3>BIGMAC: AIEEE, neither internal nor external MDIO available! <3>BIGMAC: mgmt_pal[%08x] tcvr_pal[%08x] <3>%s: PHY reset failed. <6>%s: Link is now up at %s. 100baseT10baseT<3>%s: Link down, cable problem? <3>%s: Error, cannot re-init the BigMAC. <3>%s: Aieee, link timer is asleep but we got one anyways! <3>bigmac_is_medium_rare: QEC_ERROR, QEC_BMAC_ERROR, BMAC_ERROR, TXD_ERROR, TX_LATE_ERROR, TX_PARITY_ERROR, TX_SBUS_ERROR, RX_DROP_ERROR, RX_SMALL_ERROR, RX_LATE_ERROR, RX_PARITY_ERROR, RX_SBUS_ERROR, RESET <5>%s: Memory squeeze, deferring packet. BIG MAC<3>BIGMAC: Can't order irq %d to go. <3>%s: transmit timed out, resetting <3>%s: Transmitter access conflict. <6>%s<6>%s: BigMAC 100baseT Ethernet %2.2x%c <3>BIGMAC: Device does not have 2 and 3 regs, it has %d and %d. <3>BIGMAC: Would you like that for here or to go? ranges<3>BigMAC: Aieee, bogus QEC range for space %08x BigMAC QEC Global Regs<3>BIGMAC: Cannot map QEC global registers. <3>BigMAC: AIEEE, QEC is not in BigMAC mode! burst-sizesBigMAC QEC Channel Regs<3>BIGMAC: Cannot map QEC channel registers. BigMAC Primary Regs<3>BIGMAC: Cannot map BigMAC primary registers. BigMAC Transceiver Regs<3>BIGMAC: Cannot map BigMAC transceiver registers. BigMAC Init Blockboard-versionBigMAC BufsqecbeDMA timeoutmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt...  scsipX@(Enclosure Unknown Communications Medium Changer Optical Device Scanner CD-ROM WORM Processor Printer Sequential-AccessDirect-Access NetRAID-4MPERCRAIDTSLPV530FDELLDISKRAIDDGCLDMegaRAIDCDROMTOSHIBAJ.86jaz 1GBiomegaPD-1MATSHITAPD-1 ODX654PLOGICAL VOLUMECOMPAQHSG80DECFastness CryptonCipherIPUBJDCANONMD21/S2 ESDIEMULEXCD-ROM DRM-604XCD-ROM DRM-602XCD-ROM DRM-600PIONEERMJ-5.16SMJ-4.8SNAKAMICH3.10CDX7405LASOUNDCDC-4XREGALMBR-7.4MBR-7NRCI325VMFloptical F*8IINSITEIo20S *FIOMEGACD-ROM CDU-80015.61ScanMaker IIMICROTEKScorpioRELISYS6119CD-R CR-2201CSMITSUMI1.0cCRW6416SCRW8424SCDR1021.00CDR100YAMAHAC2500AC1790A3226C1750AHP6.64CP525SANKYO1.31CDR-H93MV0F0CFIREBALL ST4.3SPD1225S3110LPS525SQUANTUMTEXELRV MMT-2ST/45S2-271.06CD-ROM1.0HCD-R55STEACU07TDC 3600TANDBERGCD-ROM CDU-80121.7xCD-ROM CDU-5611.0iCD-ROM CDU-55S4.3dCD-ROM CDU-541SONY6538ST1581921ST296|jST157NSEAGATE1.20CRD-250SSANYO2.33RO3000SRODIMEV4-2PCA80SCPHILIPS1.0CD-ROM DRIVE:841NEC*4110MICROP2.03RENO CD-ROMX2AMEDIAVISB7BXT-8760SB5AXT-4170SI1.2MXT-1240SB3CXT-4380SPR02XT-3280MAXTOR2.06CDD521/10IMSCR21DK314CCM81DK312CHITACHIVDRD-25XDENONQ14CD-ROM CDS-535H42CD-ROM CDS-431CHINON1.03IMAGERY 2400SPAashimascsi%d : added to blocked host list. scsi_logging_setup : usage scsi_logging_level=n (n should be 0 or non-zero) scsi_luns_setup : usage max_scsi_luns=n (n should be between 1 and 8) Unable to obtain scsi_result buffer scan_scsis: DANGER, no command blocks scsi: unknown type %d Unlocked floptical drive. scsi: scan_scsis_single: Cannot malloc scan_scsis_single: Host queue == NULL No device passed to scsi_request_queueable(). Inactive in scsi_request_queueableNo device passed to scsi_allocate_device(). Attempt to allocate device channel %d, target %d, lun %d No device found in scsi_allocate_device Invalid or not present host. scsi: trying to call schedule() in interrupt, file %s, line %d. scsi.cscsi_free:Bad memory alignmentscsi_free:Trying to free unused memoryscsi_free:Bad offsetscsi_build_commandblocks: want=%d, space for=%d blocks scsi : detected %d SCSI %s%s stotal. scsi_dev_init: DANGER, no command blocks Vendor: %c Model: Rev: Type: %s ANSI SCSI revision: %02x CCS Attached devices: %s nonedumpadd-single-devicescsi singledevice %d %d %d %d remove-single-deviceSCSI DMA pool memory leak %d %d resize_dma_pool: unknown device type %d scsi::resize_dma_pool: WARNING, dma_sectors=%u, wanted=%u, scaling WARNING, not enough memory, pool not expanded Failure to register low-level scsi driverscsi%d : %s scsi : %d host%s. SCSI device not inactive - rq_status=%d, target=%d, pid=%ld, state=%d, owner=%d. Device busy??? Attached usage count = %d scsi_hostadaptermapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutSun ESP 100/100a/200Too many extra bytes requested Device already registeredFailure to register low-level scsi driverscsi%d : %s scsi : %d host%s. smapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... SCSI device (ioctl) reports ILLEGAL REQUEST. <6>Device not ready. Make sure there is a disc in the drive. SCSI error: host %d id %d lun %d return code = %x Sense class %x, sense error %x, extended sense %x mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... UNKNOWN0x%02x %02x 0x%0x [valid=0] Info fld=0x%x, FMK EOM ILI CurrentDeferredInvalid%s %s%s: sns = %2x %2x ASC=%2x ASCQ=%2x Non-extended sense class %d code 0x%0x Raw sense data:%02x %02xscsi%d : destination target %d, lun %d command = Hostbyte=0x%02x Driverbyte=0x%02x mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... $Header: /mnt/ide/home/eric/CVSROOT/linux/drivers/scsi/scsi_error.c,v 1.10 1997/12/08 04:50:35 eric Exp $scsi: trying to call schedule() in interrupt, file %s, line %d. scsi_error.cMissing scsi error handler thread cannot allocate scsi_result in scsi_request_sense. cannot allocate scsi_result in scsi_test_unit_ready. scsi_unjam_host: Miscount of number of failed commands. scsi_eh_%dDMA timeoutmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... SCSI host %d abort (pid %ld) timed out - resetting SCSI host %d channel %d reset (pid %ld) timed out - trying harder SCSI host %d reset (pid %ld) timed out - trying to shake it loose SCSI host %d reset (pid %ld) timed out again - probably an unrecoverable SCSI bus or device hang. scsi%d: device driver called scsi_done() for a synchronous reset. scsi%d : channel %d target %d lun %d request sense failed, performing reset. Internal error %s %d scsi_obsolete.cscsi%d, channel %d : RESERVATION CONFLICT performing reset. Internal error %s %d status byte = %d scsi: unsupported message byte %d received scsi%d channel %d : resetting for second half of retries. Internal error in file %s, line %d. Stale command on %d %d:%d appears to have died when the bus was reset scsi : aborting command due to timeout : pid %lu, scsi%d, channel %d, id %d, lun %d SCSI bus is being reset for host %d channel %d. DMA timeoutmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... $Header: /mnt/ide/home/eric/CVSROOT/linux/drivers/scsi/scsi_queue.c,v 1.1 1997/10/21 11:16:38 eric Exp $mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... %s The driver does not yet support the proc-fs Not enough memory to register SCSI HBA in /proc/scsi ! %dHost: scsi%d Channel: %02d Id: %02d Lun: %02d Vendor: %c Model: Rev: Type: %s Unknown ANSI SCSI revision: %02x CCS mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... scsidisk I/O error: dev %s, sector %lu end_scsi_request: buffer-list destroyed sd%csd%c%cdisksdsd.c: linked page request (%lx %x)scsi%d: MEDIUM ERROR on channel %d, id %d, lun %d, CDB: SCSI disk error : host %d channel %d id %d lun %d return code = %x scsidisk: request list destroyedscsidisk: block not lockedsd.c:Bad block number/count requestedsd.cBad block number/count requestedUnknown sd command %d Warning: SCSI DMA buffer space running low. Using non scatter-gather I/O. Warning - running *really* short on DMA buffers Use sg, count %d %x %d maxsg = %x, counted = %d this_count = %d [%p %lx] {%d:%p %p %d} OoopsRan out of DMA buffers.sd.c:Bad block number requestedSCSI disk request error: invalid device. %s: Spinning up disk....not responding... ready %s : READ CAPACITY failed. %s : status = %x, message = %02x, host = %d, driver = %02x %s : extended sense code = %1x %s : sense not available. %s : block size assumed to be 512 bytes, disk size 1GB. %s : sector size 0 reported, assuming 512. %s : unsupported sector size %d. scsi : deleting disk entry. SCSI device %s: hdwr sector= %d bytes. Sectors= %d [%d MB] [%d.%1d GB] %s: test WP failed, assume Write Protected %s: Write Protect is %s onoffUnable to get major %d for SCSI disk Detected scsi %sdisk %s at scsi%d, channel %d, id %d, lun %d removable scsi_devices corrupt (sd)Device busy for revalidation (usage=%d) mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... scsidisk I/O error: dev %s, sector %lu end_scsi_request: buffer-list destroyed mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... CD-ROM I/O error: dev %s, sector %lu end_scsi_request: buffer-list destroyed cdromsrsr.c: linked page request (%lx %x)sr%d: CD-ROM error: command was: <6>sr%d: CD-ROM not ready. Make sure you have a disc in the drive. scsi%d: MEDIUM ERROR on channel %d, id %d, lun %d, CDB: scsi%d: VOLUME OVERFLOW on channel %d, id %d, lun %d, CDB: SCSI CD error : host %d id %d lun %d return code = %03x CD-ROM: request list destroyedCD-ROM: block not lockedsr: can't switch blocksize: in interrupt Unknown sr command %d Warning - running *really* short on DMA buffers SCSI DMA pool exhausted.Bad sr request listWarning: Running low on SCSI DMA buffers Detected scsi CD-ROM sr%d at scsi%d, channel %d, id %d, lun %d scsi_devices corrupt (sr)sr%d: unsupported sector size %d. cartridge changerchangerpop-uptraycaddysr%i: scsi3-mmc drive: %dx/%dx %s%s%s%s%s%s writer dvd-ram cd/rw xa/form2 cdda sr: SCSI DMA pool exhausted.Unable to get major %d for SCSI-CD sr%dmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... SCSI DMA pool exhausted.<6>sr%d: disc change detected. <6>sr%d: CDROM not ready yet. <6>sr%d: CDROM not ready. Make sure there is a disc in the drive. <3>sr%d: CDROM (ioctl) reports ILLEGAL REQUEST. <3>sr%d: CDROM (ioctl) error, command: srHosed while obtaining audio mode page Hosed obtaining mask for audio mode page (CDROMVOLREAD) Hosed while obtaining audio mode page CDROM does'nt support READ CD (0xbe) command mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... NECCD-ROM DRIVE:25CD-ROM DRIVE:36CD-ROM DRIVE:83CD-ROM DRIVE:84 TOSHIBA<6>sr%d: Hmm, seems the drive doesn't support multisession CD's <6>sr%d: Hmm, seems the cdrom doesn't support multisession CD's <4>sr%d: No finished session <4>sr%d: unknown vendor code (%i), not initialized ? mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutespRATNSATNTPADMSGACCEPTEDINICMDSEQCOMPTRANSINFORCVCMDSEQRCVDATARCVCMDRCVMSGDISCTRGTCMDCOMPSEQTERMSEQDISCSEQSNDDATASNDSTATUSSNDMSGSLCTATN3DISSELRESELENSLCTRESELSLCTATNSTOPSLCTATNSLCTNATNRESLCTSEQRSTSCSIRSTESPFIFO_FLUSHESP_NOPESP_Unknown%s%s+DMASTATUS<%s,MSG_INunknownMSG-OUTSTATUSCOMMANDDATA-INDATA-OUTTRANS_DONE,TCOUNT_ZERO,P_ERROR,SPAM,IRQ,>INTREG< SLCT_NATN SLCT_ATN RSLCT FDONE BSERV DISCNCT ILL_CMD SCSI_BUS_RESET STEP<%s>CMD_SENT_OKUNKNOWNCMD_BYTES_LOSTNOT_IN_CMD_PHASE1BYTE_MSG_SENTSLCT_ARB_CMPLTUNISSUEDSLCTNORMSLCTSTOPSLCTMSGSLCTTAGSLCTSNEGDATAINDATAOUTDATADONEMSGINMSGINCONTMSGINDONEMSGOUTMSGOUTDONECMDBEGINCMDENDFREEINGCLUELESSABORTONEABORTALLRESETDEVRESETBUSTGTERROResp: what could it be... I wonder...Cannot register ESP SCSI hostNo esp in hostdatanamedmaespdmaCannot find dvma for ESP%d's SCSI esp%d: can't use my espdma ESP RegistersESP registers unmappableESP DVMA Cmd BlockESP DVMA transport area unmappableSparc ESP SCSICannot acquire ESP irq lineesp%d: IRQ %d esp%d: IRQ %s initiator-idscsi-initiator-iddifferentialDifferential clock-frequencySCSI ID %d Clk %dMHz CCF=%d TOut %d burst-sizesNCR53C90(esp100) NCR53C90A(esp100a) NCR53C9XF(espfast) NCR53C9x(esp236) No SBUS in esp_detect()SUNW,espSUNW,fasESP: Total of %d ESP hosts found, %d actually in use. Sparc ESP100 (NCR53C90)Sparc ESP100A (NCR53C90A)Sparc ESP236Sparc ESP236-FASTSparc ESP366-HMESparc ESP100A-FASTBogon ESP revisionSparc ESP Host Adapter: PROM node %08x PROM name %s ESP Model ESP100 ESP100A ESP236 FAS236 FAS100A FAST Happy Meal FAS Unknown! DMA Revision Rev 0 ESC Rev 1 Rev 1 Rev 2 Rev 3 Rev 1+ Rev HME/FAS Live Targets [ %d ] Target # config3 Sync Capabilities Disconnect Wide %d %08lx [%02lx,%02lx] %s yesno%s esp: esp_exec_cmd and issue queue is NULLesp%d: esp_command() called... [tgt<%02x> lun<%02x> pphase<%s> cphase<%s>]esp%d: dumping state esp%d: dma -- cond_reg<%08x> addr<%08x> esp%d: SW [sreg<%02x> sstep<%02x> ireg<%02x>] esp%d: HW reread [sreg<%02x> sstep<%02x> ireg<%02x>] esp%d: current command esp%d: disconnected esp%d: Aborting command esp%d: Resetting scsi bus panicing esp: done() called with NULL esp->current_SCesp%d: Weird, being reselected but disconnected command queue is empty. esp%d: data bad parity detected. esp%d: !BSERV after data, probably to msgout esp%d: yieee, bytes_sent < 0! esp%d: csz=%d fifocount=%d ecount=%d esp%d: use_sg=%d ptr=%p this_residual=%d esp%d: Forcing async for target %d esp%d: Data transfer overrun. esp%d: bogus_data during end of data phase esp%d: Target will not disconnect esp%d: last msg not disc and not cmd cmplt. esp%d: Eieeee, reconnecting unknown command! QUEUE DUMP esp%d: issue_SC[<%02x,%02x>] esp%d: current_SC[esp%d: disconnected_SC[esp%d: got status only, esp%d: and _not_ COMMAND_COMPLETE esp%d: bad parity somewhere mout=%2x esp%d: whoops, disconnect esp%d Disconnect amidst phases, pphase<%s> cphase<%s>, device is bolixed device reset successful device abort successful esp%d: Bizarre bus phase %2x. esp%d: STEP_ASEL for tgt %d esp%d: Failed synchronous negotiation for target %d lun %d esp%d: Warning, live target %d not responding to selection. esp%d: Selection failure. esp%d: Currently -- esp%d: New -- esp%d: resetting bus esp%d: message in mis-carriage. esp%d: target sends identify amidst phases esp%d: msg %02x which we don't know about esp%d: target %d sends a nop esp%d: hoping for msgout FAST-WIDEFASTsynchronous<6>esp%d: target %d [period %dns offset %d %d.%02dMHz %s SCSI%s] -II<6>esp%d: target %d asynchronous esp%d: sending sdtr back, hoping for msgout esp%d: AIEEE wide msg received and not HME. esp%d: AIEEE wide transfer for %d size not supported. esp%d: Aieee, wide nego of %d size. esp%d: rejecting modify data ptr msg esp%d: in do_cmddone() but didn't get BSERV interrupt. esp%d: still in msgout, parity error assumed esp%d: disconnect, resetting bus esp%d: command in weird state %2x esp%d: Gross error sreg=%2x esp%d: No current cmd during gross error, resetting bus esp%d: DMA error %08x esp%d: no command in esp_handle() esp_handle: current_SC == penguin within interrupt!esp%d: illegal command esp%d: Forcing async and disabling disconnect for target %d esp%d: interrupt for no good reason... esp%d: BSERV or FDONE or DC while SCptr==NULL esp%d: SCSI bus reset interrupt esp%d: AIEEE we have been selected by another initiator! esp%d: Reselected while bus is busy esp%d: interrupt engine loses state, resetting bus mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutU U3#f#UfD"D"3"####$$$""3""""3DDqlogicpti<0>qlogicpti: mbox_command loop timeout #1 <0>qlogicpti: mbox_command loop timeout #2 <0>qlogicpti: mbox_command loop timeout #3 <0>qlogicpti: mbox_command loop timeout #4 <0>qlogicpti: reset_hardware loop timeout <0>qlogicpti%d: Cannot execute ISP firmware. <0>qlogicpti%d: Cannot set initiator SCSI ID. <0>qlogicpti%d: Cannot init response queue. <0>qlogicpti%d: Cannot init request queue. <0>qlogicpti%d: Aieee, firmware checksum failed!<0>qlogicpti%d: Cannot reset the ISP.<0>qlogicpti%d: Cannot stop firmware for reload. qlogicpti%d: Firmware dload failed, I'm bolixed! <0>qlogicpti%d: New firmware csum failure! <0>qlogicpti%d: AboutFirmware cmd fails. <0>qlogicpti%d: could not set clock rate. qlogicpti%d: Fuse returned to normal state. qlogicpti%d: termpwr back to normal state. qlogicpti%d: Fuse is open! qlogicpti%d: termpwr failure qlogicpti%d: You have a single ended device on a differential bus! Please fix! ptispPTI,ptispQLGC,ispqpti%d: Adapter reports no interrupt, skipping over this card.Cannot register PTI Qlogic ISP SCSI hostNo qpti in hostdatanamePTI Qlogic/ISP RegistersPTI Qlogic/ISP registers unmappablePTI Qlogic/ISP Status RegPTI Qlogic/ISP status reg unmappablePTI Qlogic/ISP SCSICannot acquire PTI Qlogic/ISP irq line qpti%d: IRQ %s initiator-idscsi-initiator-idSCSI ID %d burst-sizesclock-frequencyPTISP Response QueuePTISP Request QueueSBUS Qlogic/ISP firmware load failedPTI Qlogic/ISP tmon verification failedPTI Qlogic/ISP cannot be reset(Firmware v%d.%d.%d)isp-fcode(Firmware %s)differential [%s Wide, using %s interface] UltraFastsingle endedQPTI: Total of %d PTI Qlogic/ISP hosts found, %d actually in use. PTI Qlogic,ISP SBUS SCSI irq %s regs at %08lx PROM node %x<0>qlogicpti: Unexpected request queue overflow <0>qlogicpti%d: request queue overflow <0>qpti%d: unknown completion status 0x%04x <4>qlogicpti : Aborting cmd for tgt[%d] lun[%d] <0>qlogicpti : scsi abort failure: %x <4>qlogicpti : Resetting SCSI bus! <0>qlogicisp : scsi bus reset failure: %x <6>cdrom: entering register_cdrom <6>Uniform CD-ROM driver Revision: 3.11 <6>cdrom: drive "/dev/%s" registered <6>cdrom: entering unregister_cdrom <6>cdrom: drive "/dev/%s" unregistered <6>cdrom: entering cdrom_open <6>cdrom: Use count for "/dev/%s" now %d <6>cdrom: entering open_for_data <6>cdrom: drive_status=%d <6>cdrom: the tray is open... <6>cdrom: trying to close the tray. <6>cdrom: bummer. tried to close the tray but failed. <6>cdrom: bummer. this drive can't close the tray. <6>cdrom: bummer. the tray is still not closed. <6>cdrom: tray might not contain a medium. <6>cdrom: the tray is now closed. <6>cdrom: bummer. no disc. <6>cdrom: bummer. wrong media type. <6>cdrom: pid %d must open device O_NONBLOCK! <6>cdrom: wrong media type, but CDO_CHECK_TYPE not set. <6>cdrom: all seems well, opening the device. <6>cdrom: opening the device gave me %d. <6>cdrom: open device failed. <6>cdrom: door locked. <6>cdrom: device opened successfully. <6>cdrom: open failed. <6>cdrom: door unlocked. <6>cdrom: entering check_for_audio_disc <6>cdrom: bummer. tried to close tray but failed. <6>cdrom: bummer. this driver can't close the tray. <6>cdrom: bummer. disc isn't ready. <6>cdrom: entering cdrom_release <6>cdrom: Use count for "/dev/%s" now zero <6>cdrom: Unlocking door! <6>cdrom: entering cdrom_slot_status() <6>cdrom: entering cdrom_number_of_slots() <6>cdrom: entering cdrom_load_unload() <6>cdrom: entering cdrom_select_disc() <6>cdrom: entering cdrom_count_tracks <6>cdrom: track %d: format=%d, ctrl=%d <6>cdrom: disc has %d tracks: %d=audio %d=data %d=Cd-I %d=XA <6>cdrom: entering DVD_LU_SEND_AGID <6>cdrom: entering DVD_LU_SEND_KEY1 <6>cdrom: entering DVD_LU_SEND_CHALLENGE <6>cdrom: entering DVD_LU_SEND_TITLE_KEY <6>cdrom: entering DVD_LU_SEND_ASF <6>cdrom: entering DVD_HOST_SEND_CHALLENGE <6>cdrom: entering DVD_HOST_SEND_KEY2 <6>cdrom: entering DVD_INVALIDATE_AGID <6>cdrom: entering DVD_LU_SEND_RPC_STATE <6>cdrom: entering DVD_HOST_SEND_RPC_STATE <6>cdrom: Invalid DVD key ioctl (%d) <6>cdrom: Received invalid BCA length (%d) <6>cdrom: Received invalid manufacture info length (%d) <6>cdrom: : Invalid DVD structure read requested (%d) <6>cdrom: entering CDROMMULTISESSION <6>cdrom: CDROMMULTISESSION successful <6>cdrom: entering CDROMEJECT <6>cdrom: entering CDROMCLOSETRAY <6>cdrom: entering CDROMEJECT_SW <6>cdrom: entering CDROM_MEDIA_CHANGED <6>cdrom: entering CDROM_SET_OPTIONS <6>cdrom: entering CDROM_CLEAR_OPTIONS <6>cdrom: entering CDROM_SELECT_SPEED <6>cdrom: entering CDROM_SELECT_DISC <6>cdrom: Using generic cdrom_select_disc() <6>cdrom: entering CDROM_RESET <6>cdrom: %socking door. LUnl<6>cdrom: %sabling debug. EnDis<6>cdrom: entering CDROM_GET_CAPABILITY <6>cdrom: entering CDROM_GET_MCN <6>cdrom: CDROM_GET_MCN successful <6>cdrom: entering CDROM_DRIVE_STATUS <6>cdrom: entering CDROM_DISC_STATUS <6>cdrom: This disc doesn't have any tracks I recognize! <6>cdrom: entering CDROM_CHANGER_NSLOTS <6>cdrom: entering CDROMPLAYMSF <6>cdrom: entering CDROMPLAYTRKIND <6>cdrom: entering CDROMVOLCTRL <6>cdrom: entering CDROMVOLREAD <6>cdrom: doing audio ioctl (start/stop/pause/resume) <6>cdrom: entering CDROMPLAYBLK <6>cdrom: entering CDROMVOLUME <6>cdrom: entering CDROMSTART/CDROMSTOP <6>cdrom: entering CDROMPAUSE/CDROMRESUME <6>cdrom: entering DVD_READ_STRUCT <6>cdrom: entering DVD_AUTH <6>cdrom: entering CDROM_SEND_PACKET can't get write perms can't get read perms invalid size given <6>cdrom: entering CDROM_NEXT_WRITABLE <6>cdrom: entering CDROM_LAST_WRITTEN CD-ROM information, Id: cdrom.c 3.11 2000/06/12 drive name: %s drive speed: %d drive # of slots: Can close tray: Can open tray: Can lock tray: Can change speed: Can select disk: Can read multisession: Can read MCN: Reports media changed: Can play audio: Can write CD-R: Can write CD-RW: Can read DVD: Can write DVD-R: Can write DVD-RAM: check_medialockdebugautoejectautocloseinfocdromdevDMA timeoutnameaddressregWHOOPS: proplen for %s was %d, need multiple of %d fill_sbus_deviceWHOOPS: I got too many register addresses for %s len=%d sbus device register overflowGrrr, I didn't get a multiple of 4 proplen for device %s got %d intrGrrr, I didn't get a multiple of 8 proplen for device %s got %d Device %s has more than 4 interrupts sbusYEEE, UltraSparc sbus not found io-unitsbisbi not foundiommusbus not foundsbus%d: clock-frequencyClock %d.%d MHz device-idboard#mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... DMA timeoutDMA CONTROL<%08lx> ADDR<%08lx> CNT<%08lx> TEST<%08lx> dma%d: Revision 0 ESC Revision 1 Revision 1 Revision 2 HME DVMA gate array Revision 1 PLUS unknown dma version %x SUNW,fasdmaledmaespdma keyboard.c: do_lowercase was called - impossible do_fn called with value=%d 0123456789+-*/ ,.?pqrstuvwxylSRQMnn?BDCAoptionskeyboard-click?Unknown Keyboard ioctl: %8.8x keyboard_zsinit: no put_char parameterkeyboard: not present Sun TYPE %d keyboard detected with keyclick without keyclick kbdCould not register /dev/kbd device <6>sunmouse: Successfully adjusted to %d baud. sunmouse: bogon transaction state sunmouseSun Mouse-Systems mouse driver version 1.00 Oops: %s called nop_rs_kgdb_hooknop_rs_change_mouse_baudnop_rs_read_procnop_compute_shiftstatenop_setledstatenop_getledstatenop_setkeycodenop_getkeycodettyX-modettyX-ignore-cdttyX-rts-dtr-offoptions9600,8,n,1,-falseNo serial devices found, bailing out. mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... zs_stopzs_start zs_timer called zs_flush_charszs_writezs_write_roomzs_chars_in_bufferzs_flush_bufferzs_throttlezs_unthrottlezs_ioctlzs_closezs_close: bad serial port count; tty->count is 1, info->count is %d zs_close: bad serial port count for ttys%d: %d zs_hangupzs_openzs_open %s%d, tty overwrite. $Revision: 1.41.2.7 $Sparc Zilog8530 serial driver version %s get_zs bogon zs chip numberZilog Serialcpu-unitbootbusget_zs: couldn't find %dth bootbus obioget_zs no zs serial prom nodezsslaveaddressWHOOPS: proplen for %s was %d, need multiple of %d zilog: address propertyregCannot map zs regs intrzilog: bogon irqsget_zs whee chip not foundget_zs whee no serial chip mappableserialttyScuaCouldn't register serial driver Couldn't register callout driver Zilog8530Unable to attach zs intr tty%02d at 0x%04x (irq = %s) is a Zilog8530 Console: ttyS%d (Zilog8530) <7>OPROMSETOPT%s %s='%s' 2<6>openprom_sunos_ioctl: unimplemented ioctl <6>openprom_sunos_ioctl: cmd 0x%X, arg 0x%lX <6>openprom_bsd_ioctl: cmd 0x%X openprom_ioctl: cmd 0x%X, arg 0x%lX openprom<3>openprom: unable to get misc minor options<3>openprom: unable to find options node rtc<3>rtc: unable to get misc minor frame buffer device<3>fbcon_setup: No support for fontwidth %d <4>fbcon_setup: type %d (aux %d, depth %d) not supported fbcon_redraw_bmove width sy != dysbus%d %s fb%dfbunable to get major %d for fb devs scrollback:map:vc:offdummy device%*.*s%c[@%c%c[@%c%c[@%c%c[@%c%c%c[%d;%dHPROMoptionsscreen-#columnsscreen-#rows%c%c[@%c[@%c[%dH[%dH [%d;%dH[%d@[%d;%dH[%d;%dH[%dP[%d;%dHFIXME: bmove not handled  [%dH[%dM[%dH[%dLSUN8x16nomarginsmargins=font=noblinkCould not allocate sbusfb structure addressheightwidthlinebytesfb%d: %s cgsixcgthree+cgthreecgRDIcgfourteenleobwtwotcxobioemulationmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... CGsixcgsix_ramcgsix_fbccgsix_teccgsix_thccgsix_daccgsix_fhcsparc68020i386TurboGXTurboGX+GXGX+cgsix at %x.%08lx TEC Rev %x CPU %s Rev %x [%s]mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... bw2_regswidthbw2: can't handle SR %02x BWtwobw2_rambwtwo at %x.%08lxmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... cgRDIcg3_regsparamsCGthreecg3_ram%s at %x.%08lxcgthreewidthcgthree: can't handle SR %02x mapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... tcx-8-bitTCX8TCX24tcx_ramtcx_tectcx_thctcx_dactcx_cplanehw-cursortcx at %x.%08lx Rev %d.%d %s8-bit only24-bit depthmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... addresscg14 not mmaped Ugh. cg14 iospaces don't match regCGfourteencgfourteen at %x.%08lx, %dMB, rev=%d, impl=%dmapioaddr: Trying to map IO space for unsupported machine. mapioaddr: sparc_cpu_model = %d mapioaddr: Halting... unmapioaddr: sparc_cpu_model = %d, halt... Leoleo_ramleo_lc_ss0_usrleo_ld_ss0leo_ld_ss1leo_lx_krnleo_lx_cursorleo at %x.%08lx0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZPROMLIB: Bad PROM version %d PROMLIB: Sun Boot Prom Version %d Revision %d memoryavailableregvirtual-memoryidpromadjust_regs: Could not find range with matching bus type... adjust_ranges: Could not find matching bus type... PROMLIB: Aieee, old SBUS driver, update it to use new prom_apply_sbus_ranges interface now! obiorangesPROMLIB: obio_ranges %d keyboardnamedevice_typeserialstdin-pathdisplaystdout-pathnamereg@%x,%xsparc_cpu_modelkernel_threadpage_offsetsparc_valid_addr_bitmapstack_toplocal_irq_countlocal_bh_countudelaymstk48t02_regsauxio_registerrequest_fast_irqsparc_alloc_iosparc_free_ioio_remap_page_rangeiounit_map_dma_initiounit_map_dma_page___f____xchg32___f_enable_irq___f_disable_irq___f___irq_itoa___f_mmu_v2p___f_mmu_unlockarea___f_mmu_lockarea___f_mmu_get_scsi_sgl___f_mmu_get_scsi_one___f_mmu_release_scsi_sgl___f_mmu_release_scsi_one_sparc_dvma_mallocsun4c_unmapioaddrsrmmu_unmapioaddrSBus_chaindma_chainsvr4_setcontextsvr4_getcontext_sigpause_commondump_threadidpromprom_root_nodeprom_getchildprom_getsiblingprom_searchsiblingsprom_firstpropprom_nextpropprom_getproplenprom_getpropertyprom_node_has_propertyprom_setpropsaved_command_lineprom_apply_obio_rangesprom_finddeviceprom_getnameprom_fevalprom_getboolprom_getstringprom_apply_sbus_rangesprom_getintprom_getintdefaultromvec__prom_getchild__prom_getsiblingbcopymemscanstrlenstrnlenstrcpystrncpystrcatstrncatstrcmpstrncmpstrchrstrrchrstrpbrkstrtokstrstrstrspn__copy_1page__memcpy__memsetbzero_1page__bzero__memscan_zero__memscan_generic__memcmp__strncmp__memmove__copy_user__strncpy_from_user__csum_partial_copy_sparc_generic__ret_efaultmemcmpmemcpymemsetmemmove__ashrdi3__ashldi3__lshrdi3__muldi3.rem.urem.mul.umul.div.udivschedule_taskflush_scheduled_tasksdequeue_signalflush_signalsforce_sigforce_sig_infokill_pgkill_pg_infokill_prockill_proc_infokill_slkill_sl_infonotify_parentrecalc_sigpendingsend_sigsend_sig_inforequest_moduleexec_usermodehelperget_module_symbolget_optionsdo_mmapdo_munmapexit_mmexit_filesexit_fsexit_sighanddaemonize__get_free_pagesfree_pages__free_pageskmem_find_general_cachepkmem_cache_createkmem_cache_shrinkkmem_cache_destroykmem_cache_allockmem_cache_freekmallockfreekfree_svmallocvfreemem_mapremap_page_rangemax_mapnrhigh_memoryupdate_vm_cacheupdate_vm_cache_conditionalvmtruncatefind_vmaget_unmapped_areazap_page_rangeinsert_vm_structbigphysarea_allocbigphysarea_freebigphysarea_alloc_pagesbigphysarea_free_pagesin_group_pin_egroup_pupdate_atimeget_superget_fs_typegetname__fputigrabiuniqueigetiget4iget_in_useiput__nameilookup_dentryopen_nameisys_closed_alloc_rootd_deleted_validated_rehashd_invalidated_moved_instantiated_allocd_lookupd_pathhave_submounts__mark_inode_dirtyget_empty_filpinit_private_filefilp_openfilp_closefputput_filpcheck_disk_change__invalidate_buffersinvalidate_inodesinvalidate_inode_pagestruncate_inode_pagesfsync_devvfs_permissionpermissioninode_setattrinode_change_okwrite_inode_nownotify_changeget_hardblocksizeset_blocksizegetblkbreadbreada__brelse__bforgetll_rw_block__wait_on_buffermark_buffer_uptodateadd_blkdev_randomnessgeneric_file_readgeneric_file_writegeneric_file_mmapgeneric_readpagefile_lock_tableposix_lock_fileposix_test_lockposix_block_lockposix_unblock_lockdputget_cached_pageput_cached_pageis_root_busyprune_dcacheshrink_dcache_sbshrink_dcache_parentfind_inode_numberis_subdirget_unused_fdvfs_rmdirvfs_unlinkvfs_rename__pollwaitread_cache_pageROOT_DEVinode_generation_countpage_cache_sizepage_hash_tablepage_hash_maskpage_hash_bits__wait_on_pagedo_nfsservctlregister_chrdevunregister_chrdevregister_blkdevunregister_blkdevtty_register_drivertty_unregister_drivertty_std_termiosblock_readblock_writeblock_fsyncwait_for_requestblksize_sizehardsect_sizeblk_sizeblk_devis_read_onlyset_device_robmapsync_devget_blkfopsblkdev_openblkdev_releasegendisk_headresetup_one_devunplug_devicemake_requesttq_diskfind_bufferinit_buffermax_sectorsmax_segmentsmax_readaheadtty_hanguptty_wait_until_senttty_check_changetty_hung_up_ptty_flip_buffer_pushtty_get_baud_ratedo_SAKconsole_printregister_filesystemunregister_filesystemregister_binfmtunregister_binfmtsearch_binary_handlerprepare_binprmcompute_credsremove_arg_zerolookup_exec_domainregister_exec_domainunregister_exec_domainregister_sysctl_tableunregister_sysctl_tablesysctl_stringsysctl_jiffiessysctl_intvecproc_dostringproc_dointvecproc_dointvec_jiffiesproc_dointvec_minmaxrequest_irqfree_irqbh_activebh_maskbh_mask_countbh_baseadd_timerdel_timermod_timertq_timertq_immediatetq_schedulertimer_activetimer_tableprobe_irq_onprobe_irq_offautoirq_setupautoirq_reportrequest_dmafree_dmadma_spin_lockcheck_regionrequest_regionrelease_region__wake_upsleep_onsleep_on_timeoutinterruptible_sleep_oninterruptible_sleep_on_timeoutscheduleschedule_timeoutjiffiesxtimedo_gettimeofdayloops_per_jiffykstatpidhashpanicprintksprintfvsprintfkdevnamebdevnamecdevnamesimple_strtoulsystem_utsnameuts_semsys_call_tablemachine_restartmachine_haltmachine_power_offregister_reboot_notifierunregister_reboot_notifier_ctypesecure_tcp_sequence_numberget_random_bytessecurebitscap_bsetsetup_arg_pagescopy_stringsdo_execveflush_old_execopen_dentryread_execsi_meminfoset_writetimesys_tz__wait_on_superfile_fsyncclear_inoderefile_buffernr_async_pages___strtokinit_fifofifo_inode_operationschrdev_inode_operationsblkdev_inode_operationsread_aheadget_hash_tableget_empty_inodeinsert_inode_hashremove_inode_hashmake_bad_inodeis_bad_inodeglobal_event__down__down_interruptible__down_trylock__upbrw_pageadd_mouse_randomnessfasync_helperdisk_nameget_write_accessput_write_accessregister_consoleunregister_consoleget_fast_timestrnicmpinit_task_union_stext_etextmodule_listproc_sys_rootproc_registerproc_unregistercreate_proc_entryremove_proc_entryproc_rootproc_root_fsproc_get_inodeproc_dir_inode_operationsproc_net_inode_operationsproc_netproc_busproc_scsiproc_scsi_inode_operationsdispatch_scsi_info_ptrproc_openprom_registerproc_openprom_deregisterlockd_uplockd_downnlmclnt_procnlmsvc_invalidate_clientnlmsvc_opslockdctlnlmsvc_grace_periodnlmsvc_timeoutnlm4_lck_denied_grace_periodnlm4_lck_deniednlm4_lck_blockednlm4_rofsnlm4_stale_fhnlm4_grantednlm4_deadlocknlm4_failednlm4_fbignlm4_lck_denied_nolocksregister_nlsunregister_nlsunload_nlsfind_nlsload_nlsload_nls_defaultutf8_mbtowcutf8_mbstowcsutf8_wctombutf8_wcstombsdev_lockctskb_over_panicskb_under_panicsock_registersock_unregistermemcpy_fromiovecmemcpy_tokerneliovecsock_createsock_allocsock_releasesock_setsockoptsock_getsockoptsock_sendmsgsock_recvmsgsk_allocsk_freesock_wake_asyncsock_alloc_send_skbsock_init_datasock_no_dupsock_no_releasesock_no_bindsock_no_connectsock_no_socketpairsock_no_acceptsock_no_getnamesock_no_pollsock_no_ioctlsock_no_listensock_no_shutdownsock_no_getsockoptsock_no_setsockoptsock_no_fcntlsock_no_sendmsgsock_no_recvmsgsock_rfreesock_wfreesock_wmallocsock_rmallocsock_rspaceskb_recv_datagramskb_free_datagramskb_copy_datagramskb_copy_datagram_iovecskb_realloc_headroomdatagram_pollput_cmsgnet_familiessock_kmallocsock_kfree_sskb_queue_locksk_run_filterneigh_table_initneigh_table_clear__neigh_lookupneigh_resolve_outputneigh_connected_outputneigh_update__neigh_event_sendneigh_event_nsneigh_ifdownneigh_sysctl_registerpneigh_lookuppneigh_enqueueneigh_destroyneigh_parms_allocneigh_parms_releaseneigh_rand_reach_timeneigh_compat_outputdst_alloc__dst_freedst_totaldst_destroynet_ratelimitnet_randomnet_srandom__scm_destroy__scm_sendscm_fp_dupfiles_statdo_mknodmemcpy_toioveccsum_partialmake_8023_clientdestroy_8023_clientmake_EII_clientdestroy_EII_clientsklist_destroy_socketsklist_insert_socketscm_detach_fdsinet_add_protocolinet_del_protocolrarp_ioctl_hookip_route_outputicmp_sendip_options_compilearp_sendarp_broken_opsip_id_countip_send_checkip_fragmentinet_family_opsin_atonip_mc_inc_groupip_mc_dec_group__ip_finish_outputinet_dgram_opsip_cmsg_recv__release_sockinet_addr_typeip_rt_ioctldevinet_ioctlip_statisticsinet_stream_opsinet_releaseinet_stream_connectinet_dgram_connectinet_acceptinet_pollinet_listeninet_shutdowninet_setsockoptinet_getsockoptinet_sendmsginet_recvmsgtcp_ehash_sizetcp_ehashtcp_listening_hashtcp_bhash_sizetcp_bhashudp_hashdestroy_sockip_queue_xmitmemcpy_fromiovecendcsum_partial_copy_fromiovecendnet_timerudp_ioctludp_connectudp_sendmsgtcp_closetcp_accepttcp_write_wakeuptcp_read_wakeuptcp_write_spacetcp_polltcp_ioctltcp_shutdowntcp_setsockopttcp_getsockopttcp_recvmsgtcp_send_synacktcp_check_reqtcp_reset_xmit_timertcp_parse_optionstcp_rcv_establishedtcp_init_xmit_timerstcp_clear_xmit_timerstcp_slt_array__tcp_inc_slow_timertcp_statisticstcp_rcv_state_processtcp_timewait_state_processtcp_do_sendmsgtcp_v4_rebuild_headertcp_v4_send_checktcp_v4_conn_requesttcp_create_openreq_childtcp_bucket_create__tcp_put_porttcp_put_porttcp_inherit_porttcp_v4_syn_recv_socktcp_v4_do_rcvtcp_v4_connectnet_reset_timernet_delete_timerudp_prottcp_prottcp_openreq_cachepipv4_specifictcp_simple_retransmittcp_transmit_skbtcp_connecttcp_make_synacktcp_tw_death_row_slotsysctl_local_port_rangetcp_port_roverudp_port_rovertcp_sync_mssnet_statisticsxrlim_allowtcp_write_xmitdev_loopback_xmittcp_regssysctl_max_syn_backlogsysctl_ip_always_defragnetlink_set_errnetlink_broadcastnetlink_unicastnetlink_kernel_createnetlink_dump_startnetlink_acknetlink_attachnetlink_detachnetlink_postrtnl_waitrtnl_rlockctrtnl_lockrtnl_unlockipv4_configdev_openin_ntoaip_rcvarp_rcvarp_tblarp_findregister_netdevice_notifierunregister_netdevice_notifierregister_inetaddr_notifierunregister_inetaddr_notifierloopback_devregister_netdeviceunregister_netdeviceregister_netdevunregister_netdevnetdev_state_changeether_setupdev_new_indexdev_get_by_indexeth_type_transinit_etherdevdev_set_allmultidev_set_promiscuitysklist_remove_socketeth_copy_and_sumalloc_skb__kfree_skbskb_cloneskb_copynetif_rxdev_add_packdev_remove_packdev_getdev_allocdev_alloc_namedev_ioctldev_queue_xmitnetdev_droppingdev_basedev_closedev_mc_adddev_mc_deletedev_mc_uploadn_tty_ioctltty_register_ldisckill_fasyncif_port_textsysctl_wmem_maxsysctl_rmem_maxltalk_setupqdisc_destroyqdisc_resetqdisc_restartqdisc_headqdisc_create_dfltnoop_qdiscregister_gifconfregister_firewallunregister_firewallcall_in_firewallcall_out_firewallcall_fw_firewallregister_8022_clientunregister_8022_clientregister_snap_clientunregister_snap_clientip_masq_get_debug_levelip_masq_newip_masq_listenip_masq_free_portsip_masq_out_getip_masq_in_getip_masq_putip_masq_control_addip_masq_control_delip_masq_control_getip_masq_user_hookip_masq_state_nameip_masq_select_addr__ip_masq_lockip_masq_m_tableip_masq_s_tableip_masq_d_tableregister_ip_masq_appregister_ip_masq_app_typeunregister_ip_masq_appip_masq_skb_replacerpc_allocaterpc_freerpc_executerpc_new_taskrpc_init_taskrpc_release_taskrpc_sleep_onrpc_wake_uprpc_wake_up_nextrpc_wake_up_taskrpc_wake_up_statusrpc_new_childrpc_run_childrpciod_wake_uprpciod_downrpciod_uprpc_create_clientrpc_destroy_clientrpc_shutdown_clientrpc_killall_tasksrpc_call_syncrpc_call_asyncrpc_call_setuprpc_clnt_sigmaskrpc_clnt_sigunmaskrpc_delayrpc_restart_callxprt_create_protoxprt_destroyxprt_set_timeoutrpcauth_registerrpcauth_unregisterrpcauth_init_credcacherpcauth_free_credcacherpcauth_insert_credcacherpcauth_lookupcredrpcauth_bindcredrpcauth_matchcredrpcauth_holdcredrpcauth_releasecredsvc_createsvc_create_threadsvc_exit_threadsvc_destroysvc_dropsvc_processsvc_recvsvc_wake_upsvc_makesockrpc_proc_initrpc_proc_registerrpc_register_sysctlrpc_proc_unregisterrpc_proc_readsvc_proc_registersvc_proc_unregistersvc_proc_readxdr_encode_stringxdr_decode_stringxdr_decode_netobjxdr_encode_netobjxdr_zeroxdr_onexdr_twoxdr_shift_iovecxdr_zero_iovecrpc_successrpc_garbage_argsrpc_system_errrpc_debugnfs_debugnfsd_debugnlm_debugio_request_lockend_that_request_firstend_that_request_lastblkelv_ioctlloop_register_transferloop_unregister_transfermd_sizemd_maxreadaheadregister_md_personalityunregister_md_personalitypartition_namemd_devmd_errormd_register_threadmd_unregister_threadmd_update_sbmd_mapmd_wakeup_threadmd_do_syncmisc_registermisc_deregistercolor_tabledefault_reddefault_grndefault_bluvideo_font_heightvideo_scan_linesvc_resizefg_consoletake_over_consolegive_up_consoleset_selectionpaste_selectionscsi_register_modulescsi_unregister_modulescsi_freescsi_mallocscsi_registerscsi_unregisterscsicam_bios_paramscsi_partsizescsi_allocate_devicescsi_do_cmdscsi_command_sizescsi_init_mallocscsi_init_freescsi_ioctlprint_commandprint_senseprint_msgprint_statusscsi_dma_free_sectorskernel_scsi_ioctlscsi_need_isa_bufferscsi_request_queueablescsi_release_commandprint_Scsi_Cmndscsi_block_when_processing_errorsscsi_mark_host_resetscsi_ioctl_send_commandscsi_sleepproc_print_scsidevicescsi_hostlistscsi_hostsscsi_devicelistscsi_device_typescdrom_get_next_writablecdrom_get_last_writtencdrom_count_tracksregister_cdromunregister_cdromcdrom_fopscdrom_number_of_slotscdrom_select_disccdrom_mode_selectcdrom_mode_senseinit_cdrom_commandfb_displayfbcon_redraw_bmovefbcon_dummyfb_confb_alloc_cmapfb_copy_cmapfb_get_cmapfb_set_cmapfb_default_cmapfb_invert_cmapsregister_framebufferunregister_framebufferfbcon_cfb8fbcon_cfb8_setupfbcon_cfb8_bmovefbcon_cfb8_clearfbcon_cfb8_putcfbcon_cfb8_putcsfbcon_cfb8_revcfbcon_cfb8_clear_marginsfbcon_mfbfbcon_mfb_setupfbcon_mfb_bmovefbcon_mfb_clearfbcon_mfb_putcfbcon_mfb_putcsfbcon_mfb_revcfbcon_mfb_clear_marginssun4c compatabilitycompatibleSparc-Linux sun4 needs a specially compiled kernel, turn CONFIG_SUN4 on. Sparc-Linux sun4e support does not exist A xP   "Linux(none)2.2.19#1 Mon Apr 2 13:29:46 EDT 2001sparc(none)#*P  @@ @@ D d6PROMqpx?3 57Xrt8A4x`dh%88^x <@@H xHxz@.\[ P{Q\|TTV|]{P|||{h|||||||P||w |Ɯ||||{|||c|ل8|R|r<|| H\|˜Lϴ6X|:4$Ð tˬ<ˬwh՘ 6T$԰| 4p 4|֔Ø0 < :|9|`@;VSX 8xKM01X| 7 :t 3X (Ot| 74`|@,||| 6||*||4IJT\||y||HѴDH|lQ||||||h|d$Ѐɀ|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||zAApA@A(A@@@@@@@x@@@@@X@@@@@@@@@@ @@@@@@@@ ?DDDpDPD8D DCCCCpCHC BBBBBpB@B A A A A A A A AAAL(LLKLLLLLp'@ddddddxe fPHhx x߼8\ xm\\O4OXhO|nPm`nHmn@mkn8m0n0m\n(m@n mlo0h@$Q[lo @$Q[lo+@$Q[lo@Q[ln@Q[lnpVxnVn-Vxn`O[l,nVxnߨVxn߀VxnO[l np4$Vx!npVx"nhDVx)n`<W]H@&nXLVxot Vxo$W]Hot\Vxop Vxo` VxoX Vx oHVx o8Vxp8$Vxp($VxpwVxp $VxpVx oh$Vx olVxo$VxoVxo$Vx/sbin/modprobeppp2dd @ @xxxxxxxxxxhxXxHx8x(XOm x0` <K nLn|(@ \ dddp``pp@p@ h|߄0h|0߄0htܬ0߄Hhܬ0߄`h|߄0htܬ߄Hhܬ߄`,4(-r,r,r,r,r,r,r,r,r,r,r,r,r,r,$r,r,r,r,r,r,r,r,r,r,rr,r,r,r,r,r,r,r,~L\@@hPHxިln\T@LH!n\h΄δD`@$*,,-%%`+6\337 4Am  8Am0. / Am  82,223l$$$ $$  @ (0$8$@$H$ P$ `$ p$)Am$$$ $!$$$ȁL#Ё$36\3AmL8 8$88 8(8088A@$8 @8 H$8 P$8 X$8 `$8<9;A@DBD(LTHE(LJdH(LM<L|NOp`P@0hk(Pkkk|knLlxm6\|3$v xxxyy$y\y@y|ĈTH@uxl<$'pXp|ɤ,ppˈ, T 4 l <  tthx p"#$##$%X& &'h!(3 ??BBEEFFGG' ' ' ' ' '''(3(3H߸(3Hߨ(3ߘ)5( ߈67 x*4*Lh(3X,7HH-5(@8)3 (/3@/|3@/3D-5(@)3 11((8 "CLCLCTCCLCLCTC$0$X$$$FxD$DEEFGHItJ|LXMMtMNOhPTQ0QS,Thl@`  UDlU`l$XUmWp0DX,s`uv`\XxhY`{Zd~(\~(^~(p`~(`WmDPWmD@bL0c deddedU`U`U`tk%`4 ''/''''0G ьdѼҼ`Ӱ`Ԅ`X`pьdьdьdьdьdٰ<ьdьdьdlX0`l X P H< 8,, (  *+ `+G  H T L D H H xT hL XD HH 8p$ (           ++--/- --8  (  @p , |  t l  p p ,| t l p h,p ` P 8 (  (  (  (  (  (  (  (  - h      P  P   P d  P    (   |      $   h  h  h  h  h     h  h  h  x `  \ `  ,  P h      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~5p  , d l        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ nLw,< l x ϴ Ѽ   ͌ 8 ֠  uLT u z=H 0 \ P X l X  !  T >D d $ & ' !p &`! # .0 .< . / / ,D / 0$   #h #`#X#Px#H#@@(%?Vx%?Vx%?Vx%?Vx%AVx%Fh[@ %Fl[@ %p?Vx&@&8&0&(&&%,)X$h .d $+Vx+Vx+Vx+Vx+[@+[@+p[@+`Vx +PVx +@Vx +0Vx + Vx +[@+Vx*Vx*Vx*m*mm*mF lnoop , 4 ,Fnoqueue , 4G`pfifo_fast$ ̐ L  ( X--- _.p..p .u0p.8.(..---------     H4p4h4`60$h u0p d` $  ' ( "\ (u0}E@(8M ;0 ;t8K [@^08K$[@^08KVx8xK,Vx8hK8[@^08XK0[@^08HK4[@^0 88K@Vx 8(K<Vx 8KDVx 8KHVx 7KLVx7KPVx7KT[@^0 ? Q <N? H pN? XN?N@H@@@8@ AAA LB$h FP    .`2 ,S )  'DP D F Bl x B W F8 Lt Yh [\QLQL \ 8` T H [x \ ( ȸ ˀ ; 8 O 30 4 /TCPQQ h0 zl i ;H j@ k k e` i, hl b ` ``RAWRhRh |` zl i x t yT | n oD l`UDP d l < < d < < < < < < d $ $ < <\ Sp dp dP@d  J$h JJxJp3A*=(-3@P3A3AAAAddd$ PVNd PNd P  U  Nd PNd P  XNd PNd P U V( , PNdNd PNdNd P0 X4 ` LW LW$VxLWVxLWVxLxWVxLhWVxLXWVx L@WVxL0WVx L WVx LWVx LWVx KWVxKmXKmZlKmZKm[MHM@M8 VD ǐ 8 V d l V h  VD ǐ 8 \ V V l i V V h  ĘM$h @4M$h CM$h A,M$h @`M$h ?M$h @!QPhVx"QPlVx#QpPpVx$QXPxVxQHW  l%Q8OVx&Q(Vx'QVx(QP|Vx)POVx*POVx POVxCPOVx2PHVxDPHVx+PxO[@^0,P`PVx-PHP[@^0.P0PVx/P PW]H^0PPVx1PPP[@^04OVx5OVx7OQVx8OQW]H^^9OUVx:OxUVx@OPUVx<O8UVx=O UVx>OVVx?NVVxNmKAN^ Vx SSxSp & % &< Uh #H Uȁh $h > WX$h Hp Wh$h Id  VD S U Y( \| ] ^ n4 mt Q l V V V c h, VD S U X \| V ^ i mt V l V V V `< f S(\pf[@\`f[@\PfVx VD xt {X |h V V } i V V V V V V h P w VD V V V i  V V V V V  VD V V V ( i  V V 8 V V  t iinhnpnxiiyp&' '\'''''z(P()**+,,TpU[[x[[h[[X[[jjXjdfx0jed jedjedjedQ@mjPm?Hmgd@mH|0mFt(m^$xlm|p hPm4l$3@d,P, ,@d,(,p(,S,   d,S,(, S,  (, S,( (, S,( (*P `PT P*P P*P (#P P#P @Pl$PCT`'PC( @P% P 4 )%.h R%. R% tR% H *%.| S%. S%x S% p P h P`PX P ,P P.HP @(P%[8,P%[00P%c(`P @ P%. P,qTd @"`|'<$p|BL|TC ABC@ E F G H I J KL@@X@X@4@4 T@  V@ X Z Y\D\J^]xcdDnpn`n3XnPnH @np8n(      nnnz( z, z, nn`nXnn,n|lHool      #+3;CScscc !1Aa  0@` ??  pxx`  UUUUUUUUUUUUUttyP8p.7*-/-2Kn,X `%K,X `Tʸf8fFxFfp0bspPPhT@T@P@dxՠڠ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*!!!!/%123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%%$ $ $ $ %$ %%% %%<%%%$%4%,%"d"e"`&:&;&e&f&c&` "%%%&B&@&j&k&<%%! <%!!!!!"!%% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~# #%%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%"")"a"e"d# #!"H"" %  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&:&;&e&f%&c&` "%%%&B&@&j&k&<%%%%! <%!!!!!"!%% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJK!*LMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~#!+ #%%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%!&"")"a"e"d# #!"H"" %) \)(@)0$)8)@)H)P)X+|xpxh`XPHX80X XX xph`XPH80( ((xph`XhPHh80(PH   xpx`PH@0( (PHxph`XH@H0(((@xh`XPH!@8( @@@ xZ3`p`=D>D?IJl|oLqrP \$ȼ\dΈѤtьT@80( (('$0Am%x%h%`%X@%HA%8B%0C% D%E%F$G%H $!$"$#$$$%$'$($)$*$+$$p$`$P$H$@$8TTxHD/ $)- (( / / / d/H$( :Am|p8SZD_dU0-$HU 1xU1|U1U1T1U8mlU@m1l8|8TxPl,@8|,1234567890-=`=/*. qwertyuiop[]789-asdfghjkl;'\ 4560zxcvbnm,./ 123 |}~z{YxZ[\]^_|y`abcdqrstuefghi|jvklmno}~pO`'^~",YYZ|,0    1234567890-=`=  qwertyuiop[] asdfghjkl;'\zxcvbnm,./    !@#$%^&*()_+~=  QWERTYUIOP{} ASDFGHJKL:"| ZXCVBNM<>?  @${[]}\= qwrtyuiop~ sghjkl zxvnm     =       =          1234567890-=`=  qwertyuiop[] asdfghjkl;'\ zxcvbnm,./      =       [[A[[B[[C[[D[[E[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~[1~[2~[3~[4~[5~[6~ $)-`A`a'A'a^A^a~A~a"A"aOAoa0A0aAAaaAEae,C,c`E`e'E'e^E^e"E"e`I`i'I'i^I^i"I"i-D-d~N~n`O`o'O'o^O^o~O~o"O"o/O/o`U`u'U'u^U^u"U"u'Y'yTHthss"yszijD l[`Pv8(H @`ŀFP@ P2Kn,X `%K,ttyS( $bc '(( T "#|$-7:8<CGKOKIIOHOHOHOHOHOHUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU ,<\|>WX\labbtdddffgiitjhjl@m\n(o o|pDpPppppppppppppO!LstxxHu<|}{t@}}HH,ψ~~~~l|88||8<<<<~~<<<><~~<fffffffff{|`8ll8 |<~~<~<~~< 0``0$ff$88||||88<<<fff$lllllll||| 0`Ɔ8ll8vv000` 000000 0 0f<l8l||||`0||0xv`0v~ x|||~~8ld`````f<ff|bfofff~p0`x |v 08<0`||0`vvffffffv~8ll8|0000`|0`Λ 0fΖ><<<6ll6l6lDDDDDDDDUUUUUUUUwwwwwwww66666666666666666666666666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666??66666666666666666666666vvxlllllll`00`~pfffff|``v~ffff<~~~~`0``|```0|~0  0~ 0`0 ~p~vv8ll8 ll<lllllp0`|||||||f0 @P@P@ X ` (D\ @ppppp p@0pP0p`p`$ (08pp p@ppp @ `00 @@P` ``p  @(((((AAAAAABBBBBB}XwXzX/obio/su@?ǐ????ː?̔?֐????E?E?F?G?h?g?j?k?w??? ? ? ? ? ? '? )? @? ?? G? H? I? y? y?!?!?!?!?!?!’?!Ē?!Ő?!ǐ?!А?!ג?!?!?!?!?!?!?"<?"=?">?"D?"H?"h?"i?"p?"r?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"ʒ?"̔?"?"?#:?#]?#_?#i?#k?#m?#?#?#?#?#?#?#?#?#?#?#?$?$"?$$?$&?$'?$(?$?$?$Ä?&?&?'?'?'?'?'Ò?'ǒ?'̔?'͐?  /?2?2?2?2?2 ?2#?2"?2!?2 ?20?2Q?2U?2U?2V?2V?2[?2\?2|?2|?2?2?2?2ِ?7?7ޖ?7?8.?8h?:#?:?:?:?:?:?;?;?; ?;%?;7?;?;?< ?< ?>ܒ?>ސ?>?????? ???@?@?@?@?@ɒ?@̐?Bx?m?m?m??K?p?p?h?r?{????q???̒???5?b?|????ϒ?????? ???j??? ?^??'??6?O???? ?+?;?I?\???א??&?5?v??????Y?x????(??;?=?a?>?\?l?x??Ӑ??C?I?N?`???Ȑ?ڒ?/???q?v??&?&?&?&?&?&?&?&?&?&?&?&?& ?&!?&"?&#?&$?&$?&%?&'?&(?&)?&*?&+?&,?&-?&.?&/?&9?&:?&;?&B?&W?&a?&w?.?/Ȓ???|/?|6?|?|??R"?R;?T?Tː?W1?W6?Y?Zh?[*?c?c?d?d??a?r?h????/?L??א???D?V?Ð?Ր??=?b??Ґ????"ߐ?"?0~?0?`ܒ?aS?l?q˰?q?q?r?r?r$?r=?rR?)????ذ???????k??<???Z???&?0?=?C?I??l?s?{?ƃ?Ɖ?ӊ??t?Ԑ?Գ?ΰ?'?j???a?r?偐?叐?坐?嵐?徐?Ɛ?ΐ?֐?????(?1?7?=?C?X?^?`?i?o?u?{?葒?蟒?襒??+?6???E?K?Q?g?u?{?铐?靐?馐?鯐?鸐?ϐ?ؐ?????"?X??K?^????ݐ???7??H?U??7?u?א??????Ɛ?͐?Ԑ?ې???9?V?r???B?m??6?[?o??????†?NQ?O)?O/?O=?Pf?Pm?P~?n?n?n?n?nϐ?o?o9?oU?oj?|w?|?X?l??~?ڃ?ڈ?ڏ?ڼ?Ð?ʐ?Ԑ?"`"`"`"` ` ` `` ` @( "  `"*  㿘=Ö  ````` ?``` ```` `    " < @   $  ! ! ! * (`"݆  `)*` : (@̐"() (!)    00 @  " "   0 @ " " H՘PՠPլPdոPPQ0R0R8RPS S(S8$SH0S<SHSTT`TDlTxTքVDV֐V֘V֠V֨VְWLָW\WWWXXXX]D]]$],]4]<^DD^TL^`T^p\^d^l^t_|_,ׄ_4׌_@ה_Lל`פ`׬`״`׼`adapaabb bb|b bbb$b,b4b<cDcLc(Tc8\cdcld td|ed؄e،fؔf8؜fHؤfXجfشfؼh@hLhph|hhhhhiX iii$i,i4k<lDlTLsdXu0dwlxxxلx$ِxٜx٤x٬xٴټD ,t8@HPX`h\ph|ڈڔڠڨڴ4xl8Xtǀ Ǡ(Ǽ0 8`@ HˀPˈ\htۀ׌یנ۔׼ۜۤP۰ބۼޘ۴ L(0<D L8T\(dTl 4t܀L܈ܐܘܠtܨ0ܸܰ pT01089,GtI J,KH8P @QtLRTU`VhWtZP݀Z݈[ݔ\tݠ\ݨ]ݰ^dݼ^^_D``DaPab bc d<,dl4fT@fLfT`Dl|t|NބO,ސޜÈޤ˜ެ8޸ߴ88 ,H  (00P8@H&P&(\)$h)@p+xvw߀w߈wߐwߘwߠwߨx ߰x߸x(x4x@xLxXxdxpx|xxxxx x(x0x8x@xHyPy Xy<`yHhyTpyxxyzzdlєӠNHOL )l ) 3 4( = = E J( M4 e p4< qD qLL qT ;\ h 8t   @  X       ̄ j k8 x yD X   6$ 9p, 98 :`D :P mX n` \h te|gh<xHK|KMNPmmPmnp$,8D8PLX`lxLXl2 4@56X6(7d0<<iDkHLlLTq\z,hzttzz{h{{{||t|||}} }~~($~,~4<DL T@\dlt|(\HHx@p ,$8DLTlXX`0\lt@ L 0LtŘ $,L8tDƜP\hpTxH<جdܠ<ݘ !d$$0$<%8H)T*\*Tdlt|LxPڌ0,ՐLՐlՐՐՐLՐՐ|ՐՐ xØՐüՐՐՐ\ՐՐ|ՐՐՐRRS S0STT@Tt(lՐpՐՐՐՐՐ`Ր ՐPՐXՐՐՐՐ(Ր0Ր8ՐՐՐՐՐՐhՐtՐՐՐՐxՐՐՐՐՐՐՐ4<D(L@tT\d@lDL\`$d<`@PXt   , $$$T$@Hd$\( ,4<(H0P@XH`Xh\phl<DX0`xOp$Kql%%%(̠qn4q ̤q8$%@l%P%`%pL%%%`qH`qXqh@qp-q.qlqnLq0q;Hq=qrr r0rHrXrhrrrrrnsjs s81sP1s`WspV sM sIsPlsw8sތs$sdstt\t(t8PtPthMtxt0tt8ttttxuu mu8,u@uPuh upux\uuuu4uu luuu$uÄuu u uuv Dvv( v0 v@ vX lvhvxv vvՐv vvvwwnw0w(xw8wHwPwXw`whdwpxwx|w~w}wwwwwHwx(x x x0Dx@xXxhk0xxhx"8xxdxx'x%x&x'yDypy y8hyHyXyxyyy0yyPyyz zzwzz0z@zPhz`z zzrz`zHzH<zE${F{({@8{Plp{``{p{{[({g{g{h`{g{m({h{{{{\|R|T| T,|0U|@J|PU|`R|hQ`|xS|W$|O|Y|pD|q|WL|[|r}rX}m`} ~}8_}P}hH}v}}}p|}n}]t}qh}~~~ ~0`~8~@~H ~X~hr~x~~T~L~~H ?$07@0P0hIDHOKMDPYXX p0@P"$`pw tXvtTkXlk0m@BTXBp*|pq0(k8v@kPnL`npnmwl}p8|u(((@XAh@`=`Ȉ8 0֬@PHhָKLl[l^0]HOVx[@W00H+XDhHxp8o@8q822(H8dHX8hpxEhDTE<(8@Pr@X8`TpDrHΜpo0o`oPh߰<AL @0BD@ Xxh(ͤд(T8ΜHXhxw,^`h/d$ 8~HdXhhhr4r`0T(<.(8,HT`$xP8x@L |041t= (>,@ 8XPh)8xhwwwx-0.Hh x'@'X'\ww w0wHwXwhwxwww      t ( p8 H XAh Yx Y @ A  b b 1 + ,L E4 J( ,8 -XH MX N4h 1@p R X VD Vx V V V V V V V0 V@ VP Vh V V W` Wh O N O, P< Ql fP i0 iLH i` ^x i nw P Q@? u 8  0 @ lX $p    8 L <  4  0 $H h` ,pA   Ť  k lH q al 0 @ X p 8 U T o F| G[ 9 H( fX8 PSP`Op  \d     tl\   S t 0 <@OP[` ǐp  \ d      h  0@@Phx d x c  c D x zl t \0 T@ P Hh Hx   ( ȸ ˀ 8 X  " d 8 "P #hP /`  0  W B F80 I H /dh ]H 2 ] Lt O 8` D DXRhQL(8Q P ` x  8PQQ R` Px t 0 @ XQhO   }T p     H0x@xP Ĥ` p H  L Sp   x d 0|P 4` x  4    ( @ THX 4p Zp [ \ ]p l ~     8 <0A@`P ` p  0A|??  ( X8FH ,XFp  A BT C D C, $ Ԝ( |@ X (p  J  `  h   H8 4P hJx      ( 8H (X h x x   l  (8 `H ` x  l   Lp  0 H HX p`  8!"#(# #8$HP-ph/x/-MH1xHl8S(kje(j@hXkhkpiDcdcc,b d(d8HXpjjjjlrX(mH$P`px!`|4$ 0@P(`hp-*$(P@Xhx12hx((-8.dH0pX.Dhx-<p174\($@= Xk(hx8_O$R0 ,8\H]`mpxmb3H,pOQR Sp0T@U4Pb`cxdddffgiit @jhPj`l@pm\n(o o|< cl< cx    @<b<@  <b<@ < `  `c `m`d`e#<b ``m`d @@ <B <Nbx!@1`@!ʀ1` 1`   <:` <:!!@ !` <:` <:!!@ !` <:a <; d!@ !` <:a <; l!@ !` <:a <; t!@ !` <:a <; |!@ !` <:a <; !@ !` <:a <; !@ !` <;` <;#<!@ !` <;` <;#D!@ !` <;` <;#L!@ !` <;` <;#T!@ !` <;` <;#\!@ !` <<a <<"!@ !` <<a <<"!@ !` <<b <=!t!@ !` <<c <=!|!@ !` <<c <=!!@ !` <<c <=!!@ !` <;cd <<!!@ !` <;cl <<!!@ !` <;ct <<!!@ !`H2``#$`%&<""<8`@ < <c *   <8< !聐 H ` <Ec<E@ <Ec<E@ <Ec<F@ <Fb<F@ <Fb<F@ <Ga(<G@ <Ga,<G@ <Ga0<Gd@ <Ga4<Gt@ <Ga8<G|@ <Ga<<G@ <Gc<H@ <Gc<H@ <Gc<H@ <Gc<H@ <H`<H@ <Ec,<Eh@ @ <C`P!`!` <Da!`!` <Db$#@ 44c@=1#@($#<!<`<G< L"2 *<< "4#!8 $@($H*/ !<!<!<`  <H"Pk $!ĺ@ $@(@+@'"@';@+@'@)7"@@( "@@&@+L@)@+l<Hkw"<@ "f. ! < 8㿘<<" b  *㿐<@'" `@N!<@.r<& .@#l<' .;"@(|< .4#<<]!<<Kc   2!!8  $$!8R@4@*@*@).!8 D$!?*2` ; 8<@<H Ԓb  %<4 Ԗ ?      ` ?@  $4!*`2 2  2<H `  <Hb@)ʐ <Hjڐ"44444444㿘<S#Ԁ` *`<M  €@@@O <K0 @ B<`c8<Ka "<KX " <K<Kb 8<K"<K Ꙓb(y 畐?, * <@@'l 'p@ !<T'h   "0" " "  8<K<0   $ hp<Kh@l    h'"  <K<T"!"`d<KP *  <<K"X鿒 * `` h *` `"`*` <Ka  " h"ؑH/ <c8<Kꅒa "<K " <K<Kzb 8<K醐"M <K  b( ?, * <@@'l 'p@ 1<K'h3<!<5<L#<7<L%<9<M'<;<M)<+<-</<Ƙ   "0" " "  8<K<⸒   &!p<Khl   ``!` #  "  ?*  "`` ! <""## $#\"`"`b<b<✐ $b<""  $""ll`d $l"" 0 0<M % 0""alal<M %al""``<M %`""tt<M %t ""<M!<"b㿘!<K#     <<X"`p'"  <K<T"`d"    <K#辒   㿀<c8<K鞒c <L<Kg4#` 2 <K  g <"c<<M`""(""<<<M`<"<a""<`"""<ll`"l# # <0<M`0"0# # <l<M`l"l@# # <`<M``"`# # <`t<M``t#`t ""<<Nb<#" *㿘<LH    8 <X"`t'" <K<T"a"d<LX   <<L"`/  ` <S"ē.   :  ``. 㿘<!< "a8   "a8a8 * a8<S"ٓ*`  0?'<L!h* `  !lh|!h*`@E 2!hH<#<O#"#"`"`<"<<O"<""<"`"`< 0<O 0" 0"`"`<!l<O!l"!l"`"`< `<O `" `8"`"`< t<O t" tT"`"`<<Ox FFFFFFG4G㿘. >  h<M s d*`<M *`<M<X` "`<X`  "`|#<[!`t€ #h:`㿘'DJ@ \!< N  D 'DN`  DJ K -'DJ? "=DJ@`'DDJ@ 5 2`2  AD<NJJ`` JK @ ` JK @ ` Ҕ  "DDJ  a b <X<N<X`<N"` ( D`<N"` PDg xD 'D<NJJ`` JK @ ` JK @ `   DD<N`'DJ`J@` JK @ ` JK @ ` K J"  <N <N$ 8渐 DJ И J   JK @ ` JK @ ` K J"  <N <N$ 8撐 vDJ  J   JK @ ` JK @ ` K J"  J`<< </`   * J`` 2*4 ##<#`8:$ 8<NJaJa``JK ``JK  ``JK "@`DDD \ <D"PJ@KkM* m2 D* `"P'DD'DJ@  `DJ@  㿘<<X @d "`<S &޺!<b<S "<N a "$c<Na <N $cԒa  <N $cԒa(ݐ <N $cԒa0Ր <N $cԐ͒a8 2<N $c<NfV!@cԀ`( <O#,*` €<N !H<N !P<N!X<N!`<N!hf< </<Nf7!p</<g <N!xf. </<Nf)!</<""c& @lcԀ @@E%<c p 5&@<["<T`<4!<4<] <<4<1<'<4+<[-<%<)<X/<87;<<7o"Pb    ` " ""#``"" 2``< &<bP@ )<4!<4<] <<4<1<'<4+<[-<%<)<X/<87;<  <c ?"c : + 2 *`@  '21!!4 a0`>&!,;<# @"a<@$!<4 <! "a   <N!e $!!@ @ ! </ "< 0&@!;#@ cԀ  ! @$!&! Ɛc@K@&@8 "C$    > 6 6 8 b` `*$Ѐ`` ``  ` ` `<N䳐!$ <N <N!$  䤐"k  $  @JÐ   @J  !<#x "  R?<Ne"0#x`    '<Nw"Xx<"`x?`<"`x" x "$"'#ȁ<   #<Ox <<O  *`8Ԗ `pdђ0 <O <  dÐ`p  ` `  㿐!<!<   !?7o9?  @@ @@"@"`@ " &1?&@  @&@@ `@`ζ@<#@?@#@<  $!ā<9x2  2`* ` <[ J `*`J 2` 㿘<[ ⬐.` ?# ?  )<#@ɒ  b.``@ (<@ * "@""% ?<"aȁ<S#<?@< 'H"` "X<[@"b/9<5<;<8X(7<<\c8<["b/9<5<;<8X7<v`x<Ub <Ub <UbȐÔ <["b<[ 20<U"<'T'#0<Ђ` ?* 0&4H'<4#)`%x4` *@ @!!b#04 2`@g`@<4 ?* " 4  @  !!K#04 2`@gɒ`H Ӑ`-?5#)`%x4` *@ @!!+#04 2`@g`@<4 ?* " 4  @  !!#04 2`@g`?  Ґ`#'?-?)`%x4` *@ @! #04 2`@gs`@<4 ?* " 4  @  ! ސ#04 2`@g\` Ԑ`#0?o p'#0?`*? 6*1<<Ђ` `" ?<U1!<U.!* ? <[<U#!H<U !`       ? <U<["-@  <U!<U!`#@$~<$$A%@<[b-`!?@@$n%$@%1%@g< ?c.@%< <  @ ?Ȑ @"    @ АE .@(X- <ἀ i<!?@"@ -<67<#)`%x4` *@ @! #04 2`@f`@<4 ?* " 4  @  ! #04 2`@f`?  Ґ`?&?Ȑ @"   <@( <UV!<US!ݒ .@X<[⬓- `2 <[b  @ 0<U!<UN@ 21/!-@`2N@`%x@<" "<"`<"` "<\\0 "\"<Ė!!<Đ 6 ""<   #<U   aW    <X!# @"? @ <#0?#"? 6"<!`  "H< <  -* @@ @ <X!@* 3`*@ "@ @@ $ *` @ @@<#0 @* 3`@*@ "@ @@ $ -* @`2…-<<<  ""`<a <"<"<! <`"< " "    2<a z<UV"<< "Ԓc ""<@< @"@b""<< "b""<8< 8"8c""<< "c""<H< H"Hcl""<Ö< L@2 << "`""<X< X"Xa""<< "aP""<X< X"Xa""<< "b""<Ė<!؀@< "~a< {<UVq"`<< "Ԓc""<@< @"@ct""<< "cH""<8< 8"8`""<< "c""<H< H"Hc""<Ö< L@2 << "a""<X< X"Xa""<< "a""<X< X"Xb0""<< "b<""<Ė<!؀@< "a"" <[#0*`<X2 *` <[ <Y<Y""a<Y, @<@d`<[b <Y#0/@dV 0<Đ( <؀  <YT a.E&0 <Ya2  ?!Т@@d=<̟<[@H<a;c 2<0* @??"<< "!2* @?" " <"a/0㿘<U#`<.c8%<['<[.)<V<Ubվ <Ub !<UcՔ?$<Uې#Ѣ<UcՈ?<Uϐ#і? p<X"$8! Ѡx`8<VԺ с UAЀ<[8  <[ `  *$Р ` $Ā#d#ƀ#d#㿘<V X<[<["b"<X< X"XaP""<< "b\""<< "b""<< "b""<< "a""<h< h"hb""<L< L"Lb""<< "Вc""<< "ؒa ""<P< P"Pa""<d< d"daD""<(< ("(a""<< "`""<< "`""<(< ("(@# # << "`""<< "al""<<< <"<cd""<h< h"h`""<< "a""<< "c ""<< "a""<<b"@"áЀ$Ā#`#ƀ#`!?% $% <ĀɄ``2 #d $Ā#`#ƀ#`֠#㿘<X< X"Xc""<< "b\""<< "b""<< "b""<< "a ""<h< h"ha`""<L< L"Lb ""<< "Вc""<< "ؒ`H""<P< P"P`d""<(< ("(a ""<d< d"d`""<< "`$""<< "c""<< "`@@""<b(< b("b(8""< <  # b""<< "c ""<<c""á㿘<V h<[<[ "M"㬁㿘<V <[ "b<[<[`    <[<[<[` ""┐ "c/㿘,Ѐ#Р Ā0<V<[  <[* <[b<[ <[b<[ "#"b<[  <"<""""`"`<#h<#h"#h"`"`<!<!"!І"`"`<"L<"L""L"`"`<!<!"!"`"`<!<!"!؆P"`"`< P< P" PD"`"`<!(<!("!(`"`"`<"d<"d""dD"`"`< < " "`"`<#<#"#8"`"`<"(<"(""("`"`<"<"""bX@""< < " D"`"`<#X<#X"#X"`"`< h< h" h"`"`<<d <""!̝㿘$ <?# &҂@ @ ` 2`&Ң#<V<[<[ """c<"<""""`"`<#h<#h"#h "`"`<!<!"!І"`"`<"L<"L""LT"`"`<!<!"!؆P"`"`< P< P" Pl"`"`<!(<!("!("`"`<"d<"d""d"`"`< < " "`"`<!<!"!H"`"`<#<#"#c@""<"(<"(""( "`"`<<e ƀ@(Ġ㿘<V <[<[ ""<< "`""<h< h"h`""<< "В`""<L< L"L`""<< "`8""<< "ؒ`\""<P< P"P`P""<(< ("(`""<d< d"d`P""<< "<@# # << "`D""<(< ("(`4""<<f 8*"áԀ<pp"b??ĺ@Ђ@@ 4 =Т@@@<@* ƀ (Ġ 8  Ƃ(Ƣ *ԠĀO<V<[<8 " ` ƂE(ƢE<#X<#X"#Xd"`"`<!<!"!\"`"`<!<!"!"`"`<"<""""`"`< < " ("`"`<!<!"!"`"`<"(<"(""("`"`< <V<[< """`<!<!"!@"`"`<(<( (#"`"`<"<""""`"`<#h<#h"#h"`"`<!<!"!І"`"`<"L<"L""L"`"`<!<!"!؆@"`"`< P< P" PL"`"`<!(<!("!("`"`<"d<"d""d|"`"`< < " @"`"`<< #"`"`<<fL ̝<[ <[""bЀH2 2`2 2`   ` <[#D* €9PH 0P3`'.`+<c8)<Ux%<U'<V+<V"z ȟ ^  aX    l` `  Ҟ0 ` s<F<Fd L#0c   " L<F<GH#0  H<G<G,"#0  ""<H<H<#0  <X<C؄ #0  " #0  "#0  ""㿘<aa "a "<a(a( "a("<`4`4 "`4?"<cc "c "<cc "c@"<b̖b̐ "b?"<aa "a @"<a a  "a "<aa "a!"<a|a| "a| "<aa "a "<b\b\ "b\ "<cc "c"<cc "c "<[ &"b<0<G 0"01# # << "c$""<b< b"bД""<#< ###bP""<< "bX""<< "`""<< "㼒a""<X< X"X"4#`#`<h< h"ha""<<< <"<c""<< "ԒbP""<@< @"@b ""<< "a""<< "a""<`` "`<# << "bH""<< "ᔒb\0# # << "bt""<< "b""<< "b""<< "b""<(< ("(b""<< "b""<b< b"b""<"8< "8#"8c""<D< D"D`,""<< "`8""<X< X"X`""<cTcT "cT?`# <x< x"xc ""<H< H"Hc4""<< "cP""<a< a"aa|""<a< a"aĄ""<c< c"c`""<cp< cp"cp!,""<a<a< "a<""<`Ȕ`Ȑ "`""<aTaT "aT""<bb "b""<l< l"lc""<< "c""<aa "a "<c0c0 "c0"<cԔcԐ "cԘ "<aa "a"<aa "a"<bb "b"<<`$"`# # << "Ж`@# # << "` "`"`<< "bX""<< "b`""<< "b ""<X< X"Xa""<< "a""<< "c""<< "Ȓc,""<< "Ԓc""<< "`L""<< "`""J<S#Ԁ`@w@ؒ  <V8 -a<V<8  b $@<VK!<2 <2   @ , @*  $@& ( @  "@4@0@"$` @8@@ 2@$`  $`$`  $`$`  $` $`@?"@"``$`8 4 *`   ``` *2`/ 2$`<V"7@[A$`` <`$b2 `* #@[/2   &$0 < `<`%I&0 0 Ā` `%&0 @[@[`@2 "`@<V"&``"0Lt<,<؄`?< < T< T" T|@"`"`< < " "`"`<< ༐!"`"`<<"H" (" << < " "`"`< < " t < " "`"`< < " "`"`<! <! "! <@"`"`<<<< <#D"`"`<<"L" " ؒ f($B($8 $h <V$h $h$h$hcH $h  <VT PP@ 2@<VIѐ#X@&@$h"@`@*"@< T< T" T8@"`"`<< #@"`"`<<"" " <`<`"`D" " <a <a "a " " <a<<a<"a<X" " <`<`"`(" "   @ `     뒢`!"@ Т Т Т Т Т Т Т Тꂠ` <B!D<la<l$@`" @ @<B!<l|@`" @ @ 㿘Š@(`ª@<[<TbP l  $` $`  Q S!< @$`$P!<<W#8aU@$P<W#8aO $`<W#8aI P $`#8<Wa@ $`P@@"`<Ww!>  $` <["`  $` $`<Wa!($Š@`ª@P "`㿘<T l ` Q S !<<[ <[ "L"<W#8b <["bL#8<Wb <["b%㿈!<f#8#8<Wc <W ʯc <W  <"`ȁ< #8(  ( (  <[#8(( ( 㿘L<#8+<[ /b %<[  <["  ` @ 2* *  * ԭ`*  Ԣ"0 bЭ`  *  ` ǝ & `  b㿘 ?<#8%<[ ' ?<X  <["  ` @ 2* *  * Ԭ@`*  آ"0 Ь@`@ *`a$ؒ@ 㿘<[" 0<#8 )* *  ` Ь@`< # ֢"0 Ь@` *``$@⠔ّ*<YԆ 6 < 0㿘!?<(<<<<?"D"a@#!8#a< 4!<9ax<[!#!? <!"`"`"`2`wr#㿘<# #? <[bL<[? "ٲ <<<[<X#8+<[ " ""   <""x x# ##`"""?<# #c8#`%? 'Ќ`b `@,*` b*  *   Ƙ ` b  =# Ђ@ " "pЂ@ Т@"p@ %<:<#8 'Ќ` `*` b*  *   _ ` b  =8 # Ђ@ " "pЂ@ Т@"p@   Њ@b#? C <["#?cc !);  Ҫ@ ƪ`8#֪`  c֪` ?ت`  &̒  Ҫ@V <`???Ӑ  Ҫ@#<`)< '<%< !<$ Ð<T l ggg g$o$o$o$o ` U W # V2b<WHR#(!< "T҄@ *@Фb/烐 0@L  <#8 2 L<" "<X!H' 㿘<XH!"<aa  "a"<a(a( "a("<`4`4 ?"`4"<cc "c"<cc "c"<b̔b̐ "b"<aa $"a"<a a   "a "<aa "a"<aa #"a"<a|a| "a|"<aa "8"a"<b\b\ "("b\"<cc "c"<cc 8<"c"<[7<"b<0<F 0"0c""<< "`\""<b< b"bД`""<< "bX""<< "bp""<< "b""<< "@# # << "c""<["X`d <h< h"h`p""<L< L"La|""<< "Вc ""<< "c""<P< P"P`""<d< d"da""<(< ("(b""<< "Ȓ`D""<<< <"<c""<< "`X""<h< h"hc` <h< h"h`""<L< L"La ""<< "Вb""<< "c,""<P< P"Pcp""<d< d"d`P""<(< ("(a""<< "ȒaP""<<< <"<a""<< "b""<h< h"hbh""<< "ؒc""<< "cx@""<X< X"X 4# # << "Ԓa`""<!@<$ !@#!@#"`"`<< "a""<< "`,""<< "`@0""<< "`T""<< "`""<a< a"a""<!< !#!`$""<(< ("(`""<< "చ`"`"`<< "`""<8< 8"8a,""<D< D"Da@""<< "aL""<T ? cT"T"<x< x"xa""<H< H"Ha""<< "a""<< "a""<< "Ēb""<< "a""<p< p"pb""<<< <"<c ""<< "ȒcD""<T< T"T`""<< "`""<l< l"l`""<aa "a""<aa "a"<c0c0 "c0"<cԖcԐ "c"<aa "a"<aa "a"<bb  "b# << "⨒`""<< "В`""<< "a""<< "b""<T< T"Tb8""<< "a@""<< "༒b""<< "c""< <  " c@""<<< <"<cl""<< "b""<X< X"Xb""<< "b""<< "b""<< "Ԓal""<< "c8""<X< X"Xb(""<a< a"a|""㿘<X "   9 <"ah㿘<G 㿘<8<D (!;<\9<1<"IJ &"Ā`<\H 6  H<[<㴄 ,1<' H 3<'`8a`8 &,&㿘<Y "(   <] "`L<YB`"8<!p |"? 6"㿘<Y!"  ܚ <\ "b8<YBE"@<` p㿐?А <Y# #/'b  i"#Y / , <Y- c 2 <Y<Y#`#7'<YycȀ  O<Y#`#7'O /<\N А 8   . @ ` ` N 2`<` ` N ` <,`"cm $ $ <G<@x 8< ԝ㿘@ @ %<[` \ɢ`@@ 㿘<<!^Ғb|㿘<] 8   " <] "b<]A <] t!   <] "`H<]A|!㿘6 .  '<]#<]%<] *@* 1.2 2 $ $`T<]`T2 "`T  $X?.`T *@*<]"8CI2 X 2<]A@"p*`ʊ`㿘%<0!,< `# " "?$" Ǫ$ <b$4 $D$@< "ch㿘<^ !8   <"`l ) <<#ܠcl'<@   ` $ 2   @" 2 $p   "`2@0<^@ܐ!H<  <<   㿘<_"@A : " < $  "?<_"XB㿘<&@2`  8!2` *` <, t @ "`* # t"` !<&$" "!$`@ $`< " *` * 0 `,8@  &@2 2`  ?$`$@$`ɻ ``*`㿘<b `#    < "c<b@S#(㿘6  +<)<#<'< %<  *@* *2 2 ?%bl  %"p<p2  `"p  $bt?*<c#2 B"bt <c@#d. <d  H   $<d@  !<9Đ $"Ā  <3  <""x$8<]c 2 )< +<dO-<d<d!4㜢 "@@#4  $ $!0$!$b +@ $ ,$ `, @ "@p"  ,"p "p<d"  b 4<d"<d!A 0 ! 4 㜀 2<dA#"4㜑2  d2<!,`2<d@A#Hђ `4`*'#   7? #  %#7㨐  !<d7#xA_?<]<#x`9%<d` 1㜖 @ {# )# ,`$ @ "@p"  ,`"p@ "@p"  @<d"<d!A. bC <d?##` `2`<]c!<d#?㿘p#<] . ` 2 c <eA b?4cJH? <e@ H ý <    3?   )?   <`"  ?쀦 ",<e@ː p,2`   <e<e@ y  @ 02 <eT`ɔ <e@ ?Y 㿘@@㿘@Qmz@@@@㿘<f p!   <] "c<f>w!(<"*` 2` *`  )< '<  %<   ** * *2 2 % T  $X< X2  `"X  $\?*<f!H2 @E\ 2<f><!x""㿘<  h!""  <"2`@4<]"#<" 㿘<E#㿘<?#́㿘@@@1<h? 6 << <<0 <<  <h<<<<<0"` " ""? 6 <h? 6 << 8 $<<0, <<  (㿘<b" 㿘@!<<"8<`TS̐<`SȐ<`SĐ<a S<adS<aS<aS<m V <]"c<m Vސ <]"c<b|S"0S<b<" 0"0$ <btS<bS<bS<c@S<cS<cS<` S{<`PSw<`Ss<`So<aSk<a`Sg<aSc<aS_<b,S[<c`SW<bSS<a<  !<"pSJ<a8 * $ @<<m Vt <]"c㿘!<#<cS3<`,S/<`pS+<`S'<`S#<a<S<aS<aS<bS<bLS<S b㿘<o"V9 <o V2"<"bp<o V+"<"bt<o  V$"<ܒ`" 0<o "V <ےb" 0㿘<h!㿘  ?А (  $ L .$ L :  :, J<"a㿘  , B<x *oa :<ʦ" = <,  @ &  2`@   `"@<ˠ  " ̒ 2    (    $( 7! ̐N  <xa r/.o-<ʠ!~<xaȐa <  ?# % <?$ H? '/ "   <$ ($ 4!$ <$ D$ 8$ @< ſ/<Ɛ" <x=!ذ?㿘<!<ƀ? "b!<J-#T   <x="?㿘<! ?  ?㿘<] 2cN`/ `,?А  #<Ơa!, p 8. !<<xaȔ`!!㿈#<!<xbI"H=b 7'7㿘<ʔ" (`     (`@  #<` 1<a "ϔ *<x=s"p(*2`$`" <x"=h a" 6*<x=]""s*2 <""`<x#H=Q  㿈<ʚ"<" 7`(< '7!<Ɣad"!<Ɣad" <x#h"=.㿘<"<`<ʐ D2D"`2`p  ? 㿘3 &?| & ? &?ې  ? 㿘<!܁㿘<# 㿘<#` # @  2 㿘<<ݐ"<<ڐ"<]c `|"@@6"@@@!@< | 6 㿘<##  ~@ <"`㿘<< !8 D ~2 < "`<:!P㿘<&<``"`" " ` %<? ,` & 8@  ($ + ( 8?& 4& 89  2 ,<]c <Pa<  S!`H<`" 0<<[#" $<\`8$H"`$<@"!@㿘< !S <c" 0㿘<& ( `N $ 0   2 (@  `$ @ $@`$ @ $@` $ @ `$ 㿘< 2 L#Ȑ L㿘<aX9  < "`d<<!㿘!<"̀  <"SG "<$";"㿘<c!<^<`! `'   # "# "#"   <]c <Ob<D#,<D#t<D#@㿘<D"܁ 㿘@!<@^#p<Đ#`5($ <c4z<@@@**$ <]c<O`́㿘<#S#<]c<O`㿘< T"  } <` "`<9"< "  }  <` "`<9v"< p#   | <g "a<9g#0<" 2``'<c)<`%<c+<b  * * #,@2 $А  % ?<,@ 2<9D#`*`*@2`@@   *@ @* #,@2 $Ԑ  %a?<,@ 2<9"#m*`<А#;ԁ㿘!<!<ec0 2`"*`2`&2`(  " "2  €  !<9 8 `!" h` 2`""㿘!<#p3I<"!<]c<Oa< "  3 㿘!<!<bc@0 2`"*`2`&2`(  " "2  €  !<8Ɛ# `!" h` 2`""㿘<-b<% <#Đ#!<#t U$<<c 㿘<:!<ܐ d<:"<b %<]<"()<'< T: `"08:`2 di@W@~<N`t<N`<N`<N~a@<Nza<Nvaȁ㿘<]c<NnbX@ <c"a\@  <`"`<#\ `<l T㿘   <? <@"(a<A<A<@<B,h <`8& & .& & & &  $t 㿘<  Ɛ!!<$"<  ȿ!"<"`  ȸ "< a" y  !<]<8!<#Na0<#Nat㿘<9#x<#!!<]<#Na<#NbHl8X㿘<& `<˨ zc'<L "  PB 2l (3 T 2g (  "c (<JcJc!``JK ``JK ``JK  ``JK "@`": ( Tk  <9# P "`<!Ԁ` @ `"$ (&   <9~# (  )`" $2 4  ] <$ <c ("c L$#  <Jb b< 9U ?<9P 0?㿘<# %<``%   㿘DH!D!D㿘D)!D!Dxذ i<cC+<aܢ 7& %"6 ڐ )<< `!7& 6 ͐ 6a< 7!2@& 6   < 8?@1<!䀢?) T-<!<! @<8א!?  777"'7Ԑ! '7'77  <8!@? 㿘<!؀` <<a!<D א<쀢?<<!"<a?$ <! @ 0? @ ?8 @  ?!<!xDȐ 8 ?#!!!<D!8} 㿘<]c<Lb,<aЀ ~<a@  2@  r?!@ d1<a@ !܀?#<a쀢?<<!耢<#`"  <8F"pR?!<$# &L? &E?K <8."#<8)"!!<Dc"8"<a!<D["В8<a!<DS"8<`<<ah8 "<a!<DC#8a!<D<#07<<˒a7#@<7#P 㿘<cXZ <Tc`   㿘N<˦!Ѐ`  <chA <cp;@ $@Ѐ mՐ h fN b5 : ,@`g OM,<~ < €C<ˀ B"aܐ??"aC<ˀ 9"a?6"aCߐ<ˀ 0"a?-"aC֐<ˀ '"a?$"a .  !<! * @, @!<  @<ː "a , @!<ˠ" , s`L@ 㿘<7T#<#L<  @N <[c$" 0㿘<~ < O!㿘<!<la <!?!"<""`"" """@"L"P"T"X"\  "< "<b?Ȁ ?"?Ȁ < cW"<k#S"<h#O"@^ @@N@;㿘<<bxt  <<!6 '? 6!@<<(cذ<m"  ' $@ `̀  #<*` !<*! <a<!"`"  㿘<  $   6#0<<ah <#`6 ?c<<l<#!<""#p!<b<!"b" ( 㿘@}TH*o`@@<" Z<!  *  %@  "@   "   `" @  @6  <!'< * ,@ $ℑ*``"   *`@ *`52` `@&  " ( 6  *   :`"   * %@ ( 2 <!`<!8`@~@r㿘< <-l<-`L* 2      *`" * `2`""  <ᔚ`8<<"`<" # <?c6?SC <- L'<-$l l?*`@  E *` "`*`  < 5/"b`L? "`  #4?V$l  4#y " #r?<+ +<+)<'<-<;<  { 4bD@w  ] X S?& $%!$  4?`<- Lc )<-?$l l. !*@ "`  *?l`L* *   "? L l* * " l *`*` " ⤀ 2% D(%% ? Lq $$l$l"4U/a, <`""a,<3#<D<!<"b#3"D<!`"U" Ȓ   㿘<<`|  <!(3 /?!<!(<ڗ* c<l"`<-<-<-<-2 ! `a!"$  "@"@"@"@`!(<j`<a"a<!"`!" <!H3k  㿘"yВ  ??"`  . <   ` <>`` " `2   2<!38W  \#m@2`   Y#-@2 ` <3'! cD2`  ,`  ;    ,` : ` >`" @@2  8<2!  *@#@<<2" ?# ? ** @2@ 2@ "@2` <   <>`yȐ |/0'L /! - \/1/2/3x  `h! p h7''7 `!8 p ؒx87( 7' '@:  Р  2 ɑ. D',!D2 %  L@N  $<-! * 2 @ <"2s$xڒ  2<<2h"5 !* ` * @ ,  ", 2  <2M"y<#t@  < #H<2=#i<#P26 @T<;<9<7<5<`/6  2*P2cX5 ْ  $ €? 2#h Ȕ  ?/ 1 $$`$0`2 ` `0 `*`1:``@`<1ސ#x5  L!<]2# $€,!D㿘<!,`!<]#2  <Ka2  <!0` <TO<1#<#4㿘ܐ 㿘א 㿘! ˔ 㿘w 㿘x㿘<!Ā`?<-b(1<- ` " < "a" < "a ?㿘<-b,!< %<-`#<$ c8!! $ <<-"< 4 *  @ $c8 #㿘<1<!< "aā㿘<?<-<<<<<<-"8"b(",#!#a #w 3<- &b <1!? w !<-  $"$ZZx(b x&"$0<1!b x?㿐5<4(E1<.@ ? <"<.`"````` @< &"@"x$  <bh4 ! <.<.%</'<0)<+<-</<㸞㼤㼨# a8 $ 4  $ $ <4 $ ,$ 0$ D$ P$ T$ X$ `$ d$ h4 $ L$ 4$ 8$ <$ @$ t4 $ $ $ ($ \<<<$  bt$ x$ $  'H<<b`  `<` <1`<2`<3`b`c!1#㼔  !$!1!! !(!,!0!4!8!`"#< 4"`0@M@ H< < #/ƒ ?㿐<#Ⱥ' '' << "#Ē <b   )<? '<>b%<?$ ( 9< < #<? <' Đ <<a8⨄$a4 #̤ȢaĬ  ?  <$ 4 4 $ `$ d$ h4 $ $ $ $$ ,$ 0$ 4$ 8$ <$ @$ D$ P$ T$ Xh$ <$ t!D<<<,<<<<b!b,$ l$ p$ x$ |$ $ $ $  "<<-L!@#<\<"!8"`` #!8<<8!@@ #!8"8)<< <  (`h#1<+<3< * $a a$"b2`"  ` ?"` ` @   <` q <  `<#Ȇ`    *  @`*@  * ` `''# <"# a?&# <`#ȟ@ #Ȑ ,c0 dO #a\ <#Ȅ!h`""<<!!#ȑ*@ `.` <"#<.!< / `H<<[#" <\`8&`H"`㿘<$" < bTz !<" $ < `;%"$b; $$ $ $ @+㿘!<?#Ȓ Ȑ<a8 $#Ȱ ` & & & 6 6 6 6 6  !<@<,b!H  <ap` $ 4 $ 4 4 4  !<@<,K!!@ <a`$   4 $ 4 4 4  !<@<,3!! ِ<a`$ 4 4 4 $  <,!g g@@K㿘<< `  < .  @  @ @"R㿘<A!$ 8"? 6"<A!`#"? 6"<A 0 <A !+!<A! '  @$ <B"!\<B<B"a`"!d㿘<<!b8  <"@-Ò 㿘<#Ƞ `  , @ a  >㿘@   " `@@ " ` 2 `@@ &` `@ 逤 ?㿘  <L c|֐ =<˒c\А 7<˒ctʐ 1<˒cdĐ +<˒cl %<˒c <˒c  <˒c <˒cD  ?# <<˒cL <  cT  ?㿘<;<"Lb<<<<;Ȗc/T  & & # & T& & 6 Z. o6 X& & 6 P& $&  \s  & \?W \<;c|& @ 㿐   /  sg  & \#?? <& p` <&`x  "`x<& d<,#X<,#`< h`0#p&  %<T+<&l    : ,@ ,͐  $l<,Ɛ#x``ϒ`4 `h `0  \  ?& \`$`00<40   $`4` $` <& l0^"$`$` 4`` <cŔ `h4`$`$@$`|$`!<` # $`   `  $` <c O 2[<<,e#<c8<c J<# C  <` 5<,D <,@ HHHo`<S#Ԁ "<K <0 <0<K! @ *@0 !  *0*  $` $`|`  $`$`$`$``| `"`|` ?"` 2<><><><?!<?$`"( pbP(& & & & @& `& . =$`$`$`$` <+֐  㿘<&|  Q <! G"|-<`"?+<)<2 `&`  $  <! `2    2 @`  2@`ɀ2  㿘 $< c ,r `  & K & ́`̐ *a0 4* (,@ @   `` 2`` *` (" @#@`̐ ޅ* 㿘<& 0 $`"  (@<@`@ ( 2 $<!"/ `"` " @"  @`2`2  qj     ""  `& $& (& $`u㿘<& &<_!<a<\c\"d'<d#<%<+<<S#Ԁ  $ 2$ $  $c @ " (*Ɛ(c@ <S㿘 ? Ȣ @  ` ``,``2``"'   "q   & \? ǒ"<&`  "`<& <*#P <<#X*& *~#& <#` V  <T h` m  <<T l h`  <#ش  : *Z$ <*S# \"$!``<*H#<V  ,`$!$!" ג``D`0<`4X`0 !k $<9 p<`@`<  4] $ <+ <`L`H  O $ <!<`XX`T #`A $ <!p<`d``  3 $ <!)p <` b * 2``4!D 4!D!D* 2   *`2  !$!4!4 $!4!< b  $!<<b ͇<S $ cԀ` $ `<"{b8$!, $!0`2$!,!$!, $!$!h˺$!c<g<g$!$!x$!|"c& & <h !耢2<h<h# `& <i<i<i!Pal& @& & `& 2. = <&  U <! G"5<3<`">x/<-<+<2 `͒H ` X ’b`     p bx 2 @y  2@`̀2 <2 㾰<& '  <! '$ "$  $<apw  2w "s<!xk 2k  "f ` 2` @ "Z T 2T @ "M G 2G   ' \' '<&<T"`   l  `h*@   l  "<& <(#@'''   ڒ $  \`" <T`l   `h*@  `l@" `` n  <&ؚ   "  " "`( H` ?Ȑ ,`"  " ? ,` @"" ? ,` "  ?"  q ,` <@Ȑ"   "    "` cX(!   2R< `0 0 '4'Ț(,``   , . @*` 0* @ 2  @* 0<''`@@+ @ * 0" @`4@ @  "@ ` ' `0`  <c 4  0  &<'# <  <'#   $ Ȱ?   M ? <'#? 2 !<  ǔ     `  @  0 0   &`  "@" "` D5<2 "  D 2`"  3<" /<-4+<  0 84 ʔ "@` < @ ʄ`x "`   $ "` `$ $  "`    . ?   Ȑ ?2 <'#`$ Ƞ?    ?2`<'#``<m#-<m+<n'<n%<n3<m5<  " ax"`," 8"`@"  "*`=  c0  @ <&Ґ!- <!` /<+<,`8&Ĕ`   h  : &  $&ah`$,` < < @&    "  \ mm   <$y'$   ( <&`  "`<& <&q#0@<&m#8<c`$` `h%<Tl    : . &[  $l<&T#h`\&(`&(`2`` " ``<&D#p<&A# 2H(` X<c5  (` @63`d  (.``0  0 @2* (+ ` `0"@(`4  "(`@ք (` ``0(` ``0(<`00`4  % &<% H @<  <%א x  &@ Ƞ? @  r ? <%"?  (!<`   (    ` 2@ "  0 0"   &(8(<`0`4 4 њ & <% l (<`<`@#`  & <%}![ (<`HP`L  ȯ & <%l!hJ ͐<a)(& & `  <a<ScԠ  &(00<!Ba&((&(,&((#Ԕ <t<u&(X&(D&(H&(\&(Đ#`4$`$`<u"<u!$`<v<v `$`@$`( $`,`=0'@* 0<%## "  " ȶ   " Ȱ 4  " Ȫ#` Ȥ l#$`\ 㿘<&  5 3<! `)"` ""@)<'<2  U!؀ 2  " K 2 W ۤ 怤@`2`  㿘@ <$#@0`  ?<&" ԁ㿘@ <$#0`<'"!㿘<& ܚ <<b <" x<#` !@"<]c8 0 8 @'<'<'< H b<}"Д<[<\"c# H`"`   㝘 `t"@`€@` <$j"ⴀ "<%<#<!< `"  Ȁ`bؖ#$U 2 <$N"ⴀ "" `"   "@ 2 "`)` ""@%<ⴀ "  $ $`"@ 2 $ $ " ؐ P(2$ 2@`2`&ⴀ   `"   "@ 2  %a 㿘<' v <'"a )<''<'+< `" `2  H/` @. `  @. `  " ``"@2 䀢`!cm &$Ȱ d<'" "#< $ `" @ 2 2#c0 $``2  "Ð 2 $"<`#@<#X<#`# a<'"<'# 㿘+"\ `<!q  $`<`x2<B<!h "& \&  & <ʀ `9< 2"$<ʔ`9<&` ` @& X! : 6  2 2, ! (9<3< "   2XX@2 `   2    2  2  \< Ѐ  < \ "?k0 $ &  `&   ` `0 <`0`4 <`<`@  & < ؐ!(<ʒaHƛ  & x& t< ͐!` <S "P  `4" T   `;* X #` &"/" \!<ʀ#<3<-<+<ʤ!"4"D""@"  <\<ʒbሔ @ј " < !<`\!" \# X <\<ʒclሔ @ " < }!!< \!@0`\"v!<#<3<-<+<ʤ!"4"D X!??&"< Xa?&""?2    < a &" &"  "b# d"* X&" &" <"@"b  Xo?    c? #@@ #? @ LK!  ` &!`2&! &!#&!沒* "@*`@&!*`#&!Ē#ܐ* @*`@*`"@ԓ/`  2&!Вb@&!̔"!0bX X      ` 2 @    "  bX  ` 2  0 0"" "   &"$. `. a/ , , ? <!"h.&". a/ ,/ 0 . b. / 0 0`<!" &" q b*? 6*. `/ 0 <<!" &". a/ , &!!" &". a/ ,&",&"0&"(."Z&!&!*? 6*."  **@  $*? & . ."U."T."W."V. . %  㿘<!<B"bĮ  <H"Ȩ 7< `H<ɰ 05<ʠ`   .<ʪ" & 2`  &Ȁ <ʐ` 2@`  2@ `@`` 2 <ʒ# <("`d㿈<<(aĬ#  /HHo`,2  6 *,    * "  $< 4` 4`"4`B`  !e ? `   $<ϐ   04d@N# 4`%  4`0   4`0 4`04`4` d  .%##".%4d. 4d@4d@bv! .%.% 4d@ 7 777775  <$m ,  +<ϑ,  7775  2$@ $Ra 4&, 4d@# 4`4`  4d@ 775n  2$" $<2!X775\  75V  2$耤@$<! 4%.$* .$: .$775<  2$耢" %$<ϐ! 2   $<77 75<# 7775  X<a<(!<B'`   "c, ` "q@<и  <ϒb* <ϒb$ <ϐb 2W <ϐ#MR%䦒 x<#H2 <#x$<,$$$  #<π <Ϡ4+< 2"&,#<<Ϡ4+<$  @cb$@ *- $` `0n c0 4 •8 $<P#@`4<`0   ‚  $<= ,$T$P `;,X`$$\,*@ $"@"$<S#`\<!<Ғ  <Ж( @F "<  @  $#<`\@-`h<`x+??$<`#?$?2 < `  $< "d      ` 2 @ "  0 0<Р <`, Вb@ * `, (,$<В`l$$<В`f$ $ <! 5 <!(4n " <!P< !p <Аa * @  &`4 &aX&aT`@ aX *  "`  `4  &a <Ր!`A<Ȑ"`Ŗ @?" <Ք" .`  : &aP#bh x?" <Ք"p` <Ր"`  : &a#&`<S#Ԁ` `, , " a , 0  `, @, & a , 㿘"&`c&@$ $   !\c$ "`  0$   ې!\㿘<c8 <S#Ԁ  <Րbࠒ 9 <"f <<Րc " < <zc   <# "p 2 <Րic0 " < "<_  <#8ca!p<"a$$  Ԁ  ϯ <B#83<Ԁ  ϣ <2<ՐՔ<Ւ͐#H<ՒcX?2<_^ @<դ#hВb@##耢 #x## <Ֆ aX. ːԀ` $ <Ւc$h<Ւc$l@T9 b!\$$?$,  b!\$" #2#`$ `bՐ!\$$$    bƐ!\$ "   0$  ߒ @Ԁ   <c "<c b  !pb $$B$ Ԁ v@ ^Ԁ`㿘<֒   && & < @@ "(  `<@" 6 (@"  $@"' + ,@" % & $ )<<& $ܐ #<<& $֐ <<& $А <<& $ʐ <<& $Đ  <<@!<  & <! 㿘 X+<)<֒a(   )<!<֐!8 <֒a@  <֐aH 26 a (<!` $ @@ 2@"@"!   `0    `0~  !80 4  $ `T`  $ P%`T㿐? 8?ϐ c '//< ( ?)'a1<B#<!< >*@*`*`*`?`<  P<<S#Ԕ <B<!"c" <c8<b<֒b T?? .#.#`H< D<[#" 0 <\ `8$`H$ D"`0 㿘<) "!<"P!< <,!զ  *a̟П@  !Հ !  d !Հ `!@<ܐ"x0P !Հ  < !Ԑ"+<B/<-<) 1<ր +<B/<-<) # m d ̀ ` ̔"    !Հ "-c c  П@ <"П@ <"П@ П€ П@ П€ ؔP}p <"㿘<C! `<#p<.& & G"  E. . & & &  ?<Ѐ`?㿘<<֐#ec㿘<."@㿘'D@D <DÐ P ''  <."Ѐ <S<8#XcԀ (  <"<@<<"<.P.  "  <"""P <זx   U ') <c8Ԁ`)   9<7<  <]c > Ő  <Nc  `<א#> <גc@ 9<7<` +<<ϐ#<"P^"b%<-<3<א)#?LԀ ` "$<$ @<ؒ`X 0?2< `ʖ cx  њ '<". " <ؔ`x "<.` }@P`耢  <t F `<i  <c 㿘!<S#Ԧ %<.;<-<7<3<)</<E+<E5<E19<<c8$#Ԁ`   <c А $  "<אc <אcȠ "  $ Т` * * @ @* * @ @**` " @* @ @ @ %c&&a%"%%&'aF@` $R <R<<."<D"`"`<Si<.<ⴔ< <<"$<p"`"`"`"` "`㿀<H< <\a<[<\< H8"##`H""/<E_Ġ( <E<<.bА<E <E    < <  `%(c<E($ $   @  , 4 4 4 4 4 $ ,$ 0$ 4$ 8$ $$ @$ D$ $ $ ($ <$ P$ T<<$ Xa<E<<<<<<#<%<'<)<+<-<""b⌢c0|"bL$ `$ d $ h$ p$ t$ x$ $ |$ $ $ $ $ $ $ $ H <ؒ` 5%5p <A pߐ <:! H'Ho`<.b5< }7<سHo`<.<a*  <?"ἀ   a"`p"@a(<.А!*  Q"/<+<  ᬡ,`,ᬒ a""@ "@*` *!a,,*@ *`( "` * @ *` ( * (@ *`a*@ *`("` * @ *`  *  * <."Ѐ "`<<bHޔ <.<!XЮ * <-<    1<-@,`  ,3 ,/ -  @`,& #  *" *b<  #! , F,  b  P, ,  b   , `,  b  ,,  b  ,,  b   ,,ؐ $" " V b*P  b ?,Đ ,  "  ,<`,  b ,,  b ,,  b ,,  b  ,,  b  ,,  b ,,~  b ,x,u  b  ,n,k  b ,e ,a "  0 *@Z"  /S  `/L  `/E 'ɑ- *# *c< #! ,1 F,.  c ,',$  c , `,  c P, ,  c ,,  c ,, # " w 'c  *o  c?,  ,ߦ  #,ِ <`,Ր  c , ,ʐ  c,,  c,,  c , `,  c ,,  c,,  c,,  c ,,  c, ,} N<.!* @J` "%J` `! @`* ?<."!<` - `- Z !'Q d`c   ,@I @F  ,@@ ,@= ,@:  0,@6  `,2  ` ,- ` ,(HHo`L   ,@ ,@ 0,@ @,@      ,@ ,@    ,@,@   ,@  ,@    ,@,@   ,@ ,@ސ   ,@ِ ,@֐   ,@ѐ ,@ΐ   ,@ɐ ,@Ɛ    ,@,@   ,@,@     ,@,@   ,@,@   ,@ ,@   ,@ ,@ ,@ ,@  ,@ 0,@   ,@ ,@}   ,@x,@u !@,   0 *@g   /_ @` /W @` /O<.  *`!<."ت `, @*`- - ?: - - ` '0 d   ,@( @%  ,@ ,@ ,@  0,@  `,  ` ,  ` ,HHo`M`   ,@ ,@ 0,@ @,@    ,@ ,@    ,@,@א   ,@ ѐ ,@ΐ    ,@,@Ő   ,@ ,@   ,@ ,@   ,@ ,@   ,@ ,@    ,@,@   ,@,@     ,@,@   ,@,@   ,@} ,@z   ,@u ,@r ,@o ,@l ,@i  0,@e   ,@` ,@]   ,@X,@U <.*`! @` F ,E,B ! @`,: ,6 ! @` ,. `,* ! @` P," , ! @` ',, ! @` , , !! @! `$`, ` ?,  , !  , <`, ! @`, ,ܐ ! @`,,Ґ ! @`, ,ǐ ! @` , `, ! @` ,, ! @`, , ! @`,, ! @`,, <.b* M<`V #<<Ebt"<E<b("+<< 2` +$`X$``4`d$`p$`8$`,$`4$`D$`\$`h$`t$`x$`$`$`$`$` $`$$`($`,$`0$`4$`8$`<$`$` $`$$`($`,$`0$`4$`8$`<$`$`@!$aax<!@` 䁊 <ya 㿈%< ` #<+  a"""a<. . + @ "`< *`(  *    * +`@ *`  !"<.* b `    -` -` -`-`   d`c4   .ސ ې   .Ր .Ґ  .ΐ  0.ʐ  /Ɛ   /  /HHo`L   .  . 0.  @.   ` . .  `  . .  `  . .  `  .} .z  `  .u .r  `  .m .j  `  .e .b  `  .] .Z  `  .T .Q  ` .L.I  `   .B.?  ` .:.7  ` .2./  ` .* .'  .# . .  0 . ` . .  `  . . *   /Đ  /Đ  /㿈V "<*`᠐ * `p <ؐ!4-`J $`   *& $ <.#* %` $ 0 "<. <.<.<. *`*`  H*` *` ? (*` A*` -`   h*` *` -`#<.b  * $a" $  * $"2 $  * $ @   * `, ?b: - - `u `  o d`c4   .gd   .^ .[  .W  0.S  /O   /J  /EHHo`M`   .4  .0 0.,  @.( &   .! .    . .    . .    . .   . .   . .   . .   . .    .ݐ .ڐ   ..Ґ     ..Ȑ   ..   ..   . .  . . .  0 .  . .   .. `* `  /`  /|`  /v 㿘Z   <!<.#T2 "㿘<.#=0 <"0#Ho`<c8P!<I<ؒb$#$#`#   <"=T?㿘</=  < #(`<#<*` *  * H ` `` ` 4`````?  4  ` `   `  ݀`<<<ް 0a<<<"c 33</`X$ 4   &`X'`#</ `X @(*`@2 @ *2 @*`@2 ``<0`X`c Մ$ < "Ѐ<# <#'``0 ( € @ Xg `  `X'` `,9`87䀥:`\ W  `** * "    + 2@*?O  OܐF `X @'<咅# :`"   2  *@*@*@   + 2@*?   *@*@*@  + 2@*?'۠  Oѐ  ` `$        < ///////// `0 / `<`  `,` `8?`$@  <ގ 0<<a! '''ĐĖȆ ̄    2@*@?   @ 2@*@?@ @ 2@*@@ `  "    + 2@*?O̠  O$'̮ `  S  O *  O 2-` 8)`Ҁ  ` 2  . * @,``: @  *  O.  Ԁ`W4`@?@*```0 ( €  a O㿘<٠  $ <J`" <#("`0</p?  <ِ  Z <#  <J `, @@ , <#  @ "  ` 㿘'DJ <J`H`HJK @ ` JK @ ` >   DD` 'DJ`  D D!</$"J@kK2D* `$"'DDJ@ ,Ր`'DD<JJ`X`X JK   JK   K J" <ِ'DJ`  <DJ@ " J@"А``א ?"@*  >D0 `#*` " <JD*```" % @0JK  JK   JK "@ $<DD`'DJ` #</ & ?$bb &$bDJ@` - 'D  ?</"b</"" <c I )<<J `#  /<. D 2" DJ@ :2 @ ’h #@c"@*  &@ %cD€ 0ՠ <#   @ `2x`  p<<c8̰<aФ<٢ a (?  ?*`2`!</`4#0 P4#0#0?4#0<ِa( (?  ?*`2`!</`4#2 "4#2#2?4#2<<ِ 8 Y 㿘D$RJ  '<<#`     @ 22` $ !D$ , W2` !DRӐ㿘<c</"@</#4  >N 0 #4@<#<cȕ*@ `Pp㿐'<٤8NL8@ ` N L@ ` N L@ `   <<3<3"#"cJ"H"HN   N J@ ` N J@ ` h   <٠ ٔ vJ@ x2sN` Β kJ  2fN<3<3"#`"cJ"X"XN !  N J@ ` N J@ ` N J@ ` JN " <N  <  &J   2 H<bH#*@J"`"`N   N J@ ` N J@ `   2N<""pN   ,2 N ,8 㿘'Q   <!"h0+<Sc؀ <' @"cؐ'  Ȧ!h"$"$"Ȁ$"0$'`$"? ʐ'H<ْb$'H $<ْb#<ْb%$% L  % <ـ b : <3/ 0`%<3# 6!$'4<3#`  `2 ``2`@@`@  '4  $'4 $'8'4 '8**&$  `: :` $'4$'8$`$` '4#* &$@'8 *`$ ?$`$`X$`d$`\$`$$`$`$`<$`0% ,<4%  % %  H$ 0?#<4 (H$ D0<%#,<&<&  $ x$ |$ 4# `$ t$ , 4# "  #PZ $" <!|/  €@~@@ @7 @M@CQ"|$'h`<"p<#`$" ($',<a@'$'" ',<#औ $' $'(.$'$"|<&<!bؐ ,"$"$"|$'d$"I  $ $ $ ,$'x` 4В?sjA 6 )P0<ِ"2` p <$c8<גc "<<ϒb   <! 9<7<5<3<1</<-<LJ@  ,2`J@ ,"`"Ȁ Ѐ *  b耢  "     2<  c ? ?< c   ( 0OРJ@  ,2`J@ ,"`h"Ȁ cЀ * \ Wb耢  P"  I  B <  :c ? ?2HLJ@  ,2`J@ ,"`""Ȁ "3 Ѐ 2+  "& b耢 2 " 2  2  <  c ?   2 㿐"< 4 %  5  %  !h6  К & 8& ,%!( "  4!  <'`@  $ '8 ,'4  @$ '`@ <ٖ m %"'`<ږ   c@%"'` <ږ * Y@%"'`<ږ(   O@'` <ږ8   @D%"%"<"x%<*"x%"| #<(%" <)%" <)%" <)%" <)%" <'%" <)%" <4%" $<)<)#b%'(cx`"—|%'|%"%'%'t%'h%'p%'l%'%'%'x%'X%'\$?$ @$$ $$ $$ "f"< X< H<ښ P2`    @8<<  `  h @8<< x "1<("'`3 #\#`<ڒ` <yY㿘" "а!h 4`M"'`<ڒ h  $"<"ax =<"  `  `p  <$! <!P <<&@%"$"$"#<#( @ `<< #H #hr  `w"Ж* 2 <!!$ 4 ! $@ 4` Б2 $`,$`8 6!  6 <'`ᨐ R & `,'8'4</ : @& <S$"|<*$"<*$" <*$"`\$" $"$"$" $"$$"$` "$'x$'|$'`!Ђ * ` 0$Ђ` ?* <4 1<#<$'\$'X'`a~h"< 4  !h" Βbx"Ь@ =<<'`@‒   0&""Ġ<ڒb/Д (OЀ $̐< J@ x<ڐ` 1 J`-<2$ <$$?<"">" $  $ $8$,  5!  <'`@⠒  % ,'8'4</  @% <*&"|<*&"<*&" <*&"<4&"d&",&"a&" <&"$"<ڤ "`@&"&'&'t&'x&'|&'X&'\x<ڔ"'`ؐ<"bb 25@ "  `2 <ڒ p`@``   " H< $*` <"Ж* 2  0   0 "* "Ж*` 2 @㿐"< 4 "Ģ!h" c  <& . &  , <&6 & 4  В $ ,$ 8`  4a <'`  $`'8< ,'4<` @$`" '`  "&"`<'`Ȓ *ۚ "&"`<'`В  њ &""<`d*'` Ě &"ܒ <*$ "&' #<4<4 "`P "`"`8"`D</<+&"|<*&"|&" cP&"<&"c&"&"&" &"$"&"&'&'t  <+<+<+!d`P&'h&'p&'l<+<*<+<+<4#ah!&'&'&'x&'| &'\ !<ꀢ   $"*@ *` 4 #  "Вa&'X""?"`"@"""`""""`"<"#"Ѐ" "Ԅ @@2 '`2 < <ې (#\ x <SԀĂ (  0Ā`( <SԀ 0Ā`8?p"'ܢ<"Ĥ !h`ǖ  <  䀤<ې! 0&'\ "&'`&"&"&"$"<ےa(  @ `? J  &'X  <<!</#<,/<+3<,5<,7<,9<,;<,+` @ *` 'X"  'X  *" "` * 'X`@  " 'X@ `#*"` * `@Ϛ`00> 6   . 0$$4 ,  $8$,4 ,'8'4"ฐ @$" &"|`P&"&" ax&"&"&""t&"b&" <,&"b$ &"܀ "` &'L&'&'t&'h&'p&'l&'&'&' &" &"x<ے!@<'`!   "Ж  3` #\㿘" $z #``  "?  @ ? $  $ `  $ $  "؀` "Ԅ "? B""" 0 ?"? B"P" "  < 4 $  $ "8"," Ȓ    " ," 8" `" h⤐ ,I  20 <#@ #`#` #` #`#`#`#` #` $#`(#`$$0  4!  <`(  $ 84*  * @ $ `<ۖ0  `<$Ԗ@  y`P<$ؖP  n$`<ۖ`  d$`<ۖp   Z$<!h$|! "$ X$  0$ '`$ 't$ '\$ 'h$ 'l$ $$``*  $'l't'l't 'h'l'tܖ?? "$.c$.$.?$.$.  B$. P$.$. ` `?*`  & &  & &  </b</<4l!1<%</#<.!</</</<.</<-$|!4c !Ȟ c`!$x$X<`$$t$h$p$l$$$爒b$\~Eִִ㿘<Jb  1<4E#p<#P`=!<4<!*` €<[!<4` p`"  <5J   n *J  * *`  `*`@ 2J *<[!!<4`#pzy  ."#p㿘 <[`*"!<"*` €<"#P<  < < < "cP  <[!<c"~*!< #< 1< $cH"T&#<  <"c8~#< ?P~?  !<<##D#cL@[@g!<#cHtLLL㿘 @B  / .`((@  `@(@) (@@ ??& & @?@(@  / (@ò 㿘<#P3<`5<59<57<5< *` €<[!܄` )<+<-<3<5<59<57<5!X  """ ` ?*`ܐ * !X"@ <#X  """ ` ?*` ܑ* cX"@ <"X  """ ` ?* @*`X!XR$ PcXNp<c8 <Yc8!<<ۢ#d c@#Β  )<+<-<3<5<59<57<5X`  "` ""   ?*` * X"@d<ےcP#Ő  <!X`  "` ""   ?* @#8*`!XT$ <cXd@#   <#X` "` ""   ?*` * cX$@ѐ  `  "@""  ?* cX*@ 8" !XXpcX&cX tx" " 㿘<<c8 "<`H  <<`PdK!@?#( $##`< XX!<S#Ԁ #&ad<ܤ P`$` /!@?"#  &ad#Ԁ  !@?  ad|͔finddevice/chosengetpropstdoutwrite On sun4u you have to use UltraLinux (64bit) kernel and not a 32bit sun4[cdem] version exitߘߤ߬ߴߘ߼\$       0 @ P ` xp p h ` X P H @ 8 0 ( !!(h!)!* !p*<!`*l!P*l!@24!8!0! !! M L   D,!)!!h!hBoot time fixup v1.6. 4/Mar/98 Jakub Jelinek (jj@ultra.linux.cz). Patching kernel for sun4c srmmu[%s]/iommu io-unit Trying to set f fixup %p to invalid function %08x Trying to set b fixup %p to invalid function %08x Trying to set s fixup %p to invalid value %08x Trying to set h fixup %p to invalid value %08x Trying to set a fixup %p to invalid value %08x Wrong address for %c fixup %p Fixup f %p refers to weird instructions at %p[%08x,%08x] Fixup b %p doesn't refer to a SETHI at %p[%08x] Fixup s %p doesn't refer to an OR at %p[%08x] Fixup h %p doesn't refer to a SETHI at %p[%08x] Fixup a %p doesn't refer to a SETHI nor OR at %p[%08x] Fixup i %p doesn't refer to a valid instruction at %p[%08x] flush_cache_all undefined in btfixup() Garbled CALL/INT patch at %p[%08x,%08x,%08x]=%08x hh0#@%HClIhv@00 d      x8.0.<00@01FFJSTTHUTXlZpdq,qLqp Xqt@vXx|z@{~|``xL՘`x $4$&D&)*H*,14 ~D|иT E NTH`Ҽl `8h\^``|o f-$:X`f-.f..f0PL4; ތf 0x2h>dXfFlLhH\HNdOQSV,W\`dgkl@sPtuwxxyyzhxdl8p¬dHɴְX4ެthD(hXT| pT`  H l`` </h46l78899:@;;AG`HHJKPPQQdRS0TU|UWWZ<Z[\]^H_0_`a8abcHcf<\0DTNP_bd\thl ͬπ@ߜ$$%'$'()+24Xvypy0DH4dTHp\@Tрӌd+2h38;@HpMN0NtO,Oejjlm`P8 xd   & ) )P 3 : < > El J ` a| b cX d e i` o, p q q< qp z ,  @ ; m $  4  4 ˼ j j x y0 D t D  D 6 6 9 9\ 9 :H ;t <@ m n l H eg4qr(@\FIKhKLMN4OZlm0mnnlXL4l02 2p24,56D677P<Ipik4km,nHqz{T}x $<<TT|<,,( <Ȱ4LˠӘ0Ԭ(ؘL|t!,$)x*lHL@dpwz`{X|}}~8~llPP 8X8P,\Àèl|HtX0pp @   FOORTRSXTY`\]@^D^x^_H_`<DL(xhfd4ffoPfr,fff|fB`4\:u$ooru|wz}04 ބ T3(ACDTDtTaf"n(ppts}t,D޸ 1PACT_(f n<p$s0}PX 1p@C,T_Hf <n\nxpDsP}px 1@T_hf.P$X4d:nlppsx}DŽ،  1@C@D\T_|h8`,npsvTxz {~@@Ǩ؜8<l 1x@CPT_f nps~xذh 1ACdT_f nnq s~4߈ 42@U_f.(D`4l:nqdqtt ~Dߠ P24A,CxDdU,_f84\hqt`vy{~P,(X2lX Ϡ$A8DU8`@fD4L|qttvyz{~p~(dx4ll2´аLҐҨALEDEhUL`x`f d4P{,|}~0Ld $<fa X {Df(,(v|`}~dH  f"4|:v@{<}\X%T%p2|f0{D|p}$dl%x22ЄE$fpT< p    @ t   (<(.d..4:r rDrdvdxz,{X||}8XD` < %22E0E<tTtzdz{@{||tf H(H(v0|}Dd X < i"LPlxGHK^,^4htfxuw~`DوDDh4pTssdsuuwx\4ޠ t181`__8h oshsuwDް p1H_ h"qsuv(xx\4Ǭ@XT 1_fqPux0z(DDhpsvxX\ǰ\@ 1_f8tXxT  0fHf@pwTyz0D|f\wpyȐ٘,EE fh   8   0 d-. Af |T!"l#,$%L&)$x'+f8""#L&df @\""#T$%T&)t8'+fx,f "@f|fDpfHsu,(su4f5d;(hTf22(2x2f447t:=p(pfrfrfrfrfJ p t ID L L R fd f , Ѭ d  < $ x 9 X h z D P $ T hccPff$f',(o|f($$f',fmsnofnfnfoHfohspa q|vL aqaqfx$fxi{4{8^H^Tf {L|h},lt%fh s,a t`i ff(ixfai@H^D^Pf  i8xff>`UchfD`fDCDfGIfGpIfi^8^<sffff ,+$+(+,+0+4+8+<+@xph `XPH@8@(90;dKx0$ COPYRIGHT 1991,1992,1993,1994 QLOGIC CORPORATION ISP1000 Firmware Version 01.31   qp ? pISpP p p?p 10 y5xc/ '  @B Qxx xxO i5@jh< !xlh(hh hhhh#hh' i6  h hhhj-  i6 h7h @hhdpxx8x/:xx32 ppxxxxx2}x}x//xxxxp p z zp@xx0x/ 5h!/xx6x 5o!e@ 5j!!! `x)xx 5o 5i! @- @xx| a`@8|ppppp 8yHVVagDk$2FZ9CJp  8y rq @xsrq @p a` P @|p@x A A Sxppzxxxx ppISpP p p?p yx 10 Y )W Qp ar P @xUqrsp 10@psr Q I4 Ap& IB ANpp q.pp@Bp   B J &Sxp @BHB&Sxp &Sxqp!^ rxppxprstprstҠ@}xrzz{~|vxxxxxxprstprst֠@xz{|xxxxxx 5Y! x 5A! x 5B! x a5@a bx 5E! x 5F! x 5G! x 5H! xyz xqā6jh@kxk xwx kj 'xwx ijk xqġxxqġ 5A"~!xuxq 1 "@#p!xx1~ 5B"!~xxd2K a5@a bp`p`x a5@ap`xq  (@c  2@c  < a5@`~a#xx3xqġ 5G"!~xxqġ 5H"~!xxqrȡ!yx "z xxqā6 rh~&@j @@@@ρ@@xxxxr̂@h@ a5@a(@衆2@<@dHxPHxCHqqrxj hhk qxwx jk phph'xqrs̡xxwx jj 'xwx jj h@Ax 'xwx jj h@Ux 'xw A I Q x 'jxwrswrsxh@'xx |  @x xww A! I Q x a5@`g`x x|wwwwƧ a5@``gxx  A! I Q xph68 |x 9 A! I Qx h i 8ݧ?8? ih0@@hK hH@ p xhK hH@px px y5x a5@```xxhh hF |xx@x`qqyJ|tsrtsr y5 @xo@x?@Zxxx` x 5h  # " $   , .%0~x/eeff`` x|p@xqpyxqq!hx ii -h p@xp@pxqrs!!yp@qrsxp@pppwqx 1&$0$"F 1xxxUUy`qqġybxy`qxyTqqyVyXqqyZy\qqy^xyTqyXqy\qxp @pppqrs 0` Sx ppq1p q p|p @KppFpqrs 0x ppp Zp lq l,Sp|xPe@w,xR c|~ y5xP b,xR| @zR @/  x | 6|x)h**h.h i 5O! h@ ``h~ x ~he@`hxxhhii|e@`` xx!x|`  @h(`h,`|~ q5@p@5- pB|~ q5@ 5r@!H!!tB|x hxe@_x),x`e@_` #`#,( 5O @_hF` `hFhxPdx `dP,h%`x`` xhh | 9 A! I Q x8j?8?j | a`xx|@xyxx` x x xx` x  xx`  xp a` @|,`, cxdxfxhyj@,xyn| ~ a5h- k`d`f`haj@-xan |x@ ~`e@x `xx|xle@ xdxf,xnxj |xeytprТ"3x@exhe @xexo@ez|{x @x?@\xxxxe xxxx xexx`yf|n}nnnn 9xx``x`xxz|x@xnx`x`@x@xxxx|xxnxx|x@xnxg `@ӧ @ 9 @xx- h+h/hh - h pxxx|xm,xx`x,h`x-`x`xxxxx `|.%0a`a@~x/eeff``gx h@? x x xxxy` F`"jh HU@U 9xzxy, he@]aiai!``hh h@@s@h xxxx|`` x xe@`x`x}xx|ypxt xvpx@xh @|h )xle@x@~x(x@ @|{yrpԢ"#|Hף||x `$@ @x@xx xxxx x xxyx xp֠|z{| 5h ~ y 5@ !4 5!4x044xD |~ # q5@ y - +#@Px##S3xCx xx p\xTpxbxxxCxSx 8pG5pC | " x[|  px" |  px! |  px" | "ϡ | ~ a`bc |" ~ a``` |" ~ a`` ` | ~ a``b `c  | ~~h@9 a?xA@' a> ~xA@ `pxx9> q5@p``q` pxx5 q5@``q` px x;   |,@X `` U`U`UxZ`xB| 5A"  ;"@j !!"|~h䠌 @`6p q@ @ 2@x x ?x !p |h~ qp. qpppÀ qp @ px~~~ #<~X|0}8?@@ا|-xPxy "%k%%&e&'D S%Jx |pp?p0@ p3p\py*Kqxx Fx$(pxx-^Ipx~xxx x`xx[ x$Ippp35pxx-^oqx~xxyxx`xx[ x$oppp35pxx-^qx~xxyx qyx x`xx[ x$ppp35pxxKx-^p hxox,,Phxn A xx-^xp\ hox,,P`` hx 1 Ax- xt@@5 0qD*H 5!de!qFpp?xv@5qD&xqF%h%Xu>,P`4gw6?@/!@@g @/`g hna@?`HB@BxHp `"g k6 ` HpJ`pN`pR*`xFx-^kpL@s@u@{ {@g xqL@) !H "H  H@z@x-wja >,d@``` ~*``` xx-^*`ay@q. ~qP@ݡ@x*ݡ@x)p`@桍yZix`(xxahhx~~~ ,x Shx~xm}}n~~x0`` x-wxr*xIx-wx;j zZxIx-wr%@;yIp2G``xQ0000QQQxxx ~ y5x@yphpxpwp hhhhhp~ q@ 5+ x 5! 5 5+ ppxpx.  9x+pxp yx !5W$@ƭh "xhox,x(xpT `h`jhhx !?x !5Wx !>x px a6`a``pxpp?x~$@ hh~jhhxx  #|P#x#y&)@/xpppy6>>@t)>t>xwx+wx,`@k !?  x@k~ !>~  x@j pjx[8Fxxwx,`@ !?   x@~ !>~   x@ pxx"yxppx"yxx$p(x(`` x(@(x$@ h-~h@- x "ihhx```` x(|x#y 5xx   0 xIxx전@!y # )  -X-X  /xp@ x"x+xUxx+xxx+xxx+xx _x$py > F S F( H( F Fxqp Qx)x(x(`` x(@(xx   0 nxIxx전@ j!y x -X-X -Pxx+xUxx+xxx+xxx+xx#y xx&ehxy䡄0@&ex전@&ey # ) -0-X-X -PxP x#y """y "xxx H+j+jy +j+j+j+ xy@ @ x+jp x'R+jy!!!!.!0!+j+j!+j+j""+j+j+j"x@!% x:xxh@!,hx-0xii!Jh!Rh!Bh@!xXx@!RxXx`@!@!!`x!z~Znxtzyx!m?k!hk"h@@!~Znp!x/:x0xgxx1jilk"@!""!|{#!@~Znxgxxg"!x0xx1xxjxxXxxx"!i@!ܡi ~pH ````` x"@"i ~pH ````` ,H @"x,x)@"x`(x~X~Z" xUxxix~X"xXxxjxx+px+p y@"xx"D#| @"<H"<x">x!$z">x"* "#@"TH"Tx"#@"hh~X 0~Z`` ~pH `` ,H @"xx,x*x" ~pH `` ,H @"x,x)@"x`(x~Z"xUxxixzx"*#@"H"x"*+vx+px+vx+jxx@"xzx+jy"+j)9+j*g"xx+xix"xx+xixP"x#y""##@"x p:py### # %%0$##x#x.@#xh@#Z#)x(`` x(@#Zx.x#A(#Zx.`` `@#A`@#A@#A`h@hhpT ~ `h` `h-#W``x~x$hh'o@###w`@#wxzh.j*6"#x#" @#h#x$x@#@ih@#p8hix(x(#`` h#x(x#pT `h`xxH#x"y#####xp@#x+xixjxxxy@#x+jxjxhh$x+x$ @$ xx+xixx-wx0$$y||`$)h/h+x$$8hH5$8x.| @$bxЀ$Fx1xx1@@$Ph/h+x$5hH5@$Jp8$\yzi.j*x$5@@$lh/h+x$5hH5@$fp8$zp;yzxЀ$?i.j*!$x$5x1|@$`` hj(i,j:i>h+h/h3 hh py$$$$$$$$$xh$x(x$pT,P `h`*` !5W$@$ x$-" k|wx+x,`@% ~ ? h  !?  x@%~ !>~  x@% p%x$8$xx(x(h'xohx1ʦ@%i ih@%$h !5Wh "j8ix& ?!h- qVn`@'@'hhhx.x'@ @'x1xЀ'xx1yzx'x,x1@'@hxtx-| x-|  '8x-|'3?k!hk"hxx+vp3P'Lx#y'O'R'\'"y'U'Z+v'Z''xp'ix(x.p4` x'np@'cp ? hp>p2"y'x+v'}''}+vxp'x(x.p4` x'p@'p ? hp>p2"y''''''xx+xixp'x(x.p4` x'p@'pzx| i?--qV h@'h@'hx'p ? hp>p2~ / p'x'jhhh#n~Zh @(Ox+x(Op(x(x.p4` x( p@(pzx|yy>--qV h@(*h@(Chx(p ? hp>p2~ / p(;x(4jhhh#n~Zh @(Ox+~Xx(O~6 `pJ`pN`pR`@(klih(t{{||ަ~Zx0x(h!#$@({{||h~Zx1x, j@( i ~Zy-p>6 Hx` @(`"`` p`&|x.hhh@hpy(((((((((xx(x(xxpxhx%h(``|`@((x``` |`@(`|x-whx)&x-whx)&x-whx)&wx,q>-- h)xhr@) hx)h hpx(h)/x(x(hh xx+j}~ii@)i@)H)Z@)Z 1++x,$@)dx*3x)x+ ~)```x*W ii~X~Z)xUxxix ~)```x*W ~X)xXxxjx ~pH `a@)bH)@) &)"0bp()¢) x)Ȣ )  ")"(x+++x,$@)x*3x)x+x*WxXxZ xix ~)``*`))a | 2 x*#bp(** x* *  cH*#@*# xxxz{hh | ~qH!` 5~`x~fxx`x7``` | ~pH ``xxx`xx |+jzii@*i+jx*x*W x,x)@*x`(x~X~Z*xUxxix~X*xXxxjx*@*qH! * x+x*x*WxXxZxix ~~)``  *`@*ᡌax* xxxzhh | ~pH `@* @`xxx`x`` |~p@+x+x+f @+fx@@+fx@+%{?+,@+M+5@+bx1xx1x+f@@+Mx+F?+b~Zyz +Vyyzzx1xgx0^xxgxxjxx+xixx+xixh#x+i ih@+hxix x+  x+ x+  x+  x+ xx~Z|~?;;6 y@+x```88y@@+ϡx```|xxxxzx`x| 1 )2xxxx}~x`x|~ xy 5F (@, !,  x, !,  d$@," #p,"x,|~ 5F"2H,8@,< !,v   2x,L(@,D !,  x,J !,  d"@,\H,\ #p,Yx,L|d,expx x전@,s$,s !x,t$|02BDTVfhxz  2BRbrfvxz|~"2BRTdtvxz|~xF| 6|yzxЀ,?|~ y 5@ !y,,,,,,,,,xxKxH,xKxH,h@hxX@xZx0,,h ,xx,x | ~h6` -.a@-. @- 2@-!x-% x-' ?x-' !` `` |xjxxixxXxxUxxxxxxxxxxxxxpxFx~x0-uxx x전!@-uxx |xx |x0@-|-x|xx x전!@--x~xx |p@- ~-`/hxk-x,h hxX?hh/h+xKx  @ x전@  x+p ~h6 ` HpJ`pN`pR | b G  0 8~*89(œèd;0(â0 (GajV:(✠d)0 0(ᜠ( dgo;p#vwxn> (+dgo;p#vw> i( D! ܢr<no00 Ht.?a22!ℨhe*#`B`*!0 ׈"(H0(0(= 0 &:  ~*8~ " I.prr p@.x.p |p/ q.x/x.p @/ p/p.p@/.px/ @/ x1k/@.x/Vp |d$@/0,p 9/5'hh 0h)!@/08'/pu@/0 9/2x/| ~ " y5 qp pp q p pp Ix | I/Vp/pqp/^0@/k0/^p/p /q //Vx/hppp/pqH/xp I|~~~~ "qx/ |r!qp /ꡄ / y/////////xp/ Ix/x1k/x|p/x/x1k/x|px/Vx,h@/h|xxx0Prqp (x@0xx03x0P',X`c ""c!$@0)0) +`x0+`/2=,holkpx/V|8'0D`@0M ` 9/2Q@0Lp| Q|P9'0] 9/8`d0]-`|~ ~ " h `hklW/2~ h@@0y~ yxX@@00pp0p@0x$0x0,X'``~p`p !0Ƞ@0Ȧ0ppvpx`p`pb $pb#pvp+`x08x0x1k0 |~ ~ " pp0p |~ ~ "  I0pp0p@1x~ h@@1h$@1 P 9/5-`x1k1 |~~~ ~ " ~ h@@10 I1h$U@1h-p.` 9/5'hh "hH1UQ1Gx8'1;pu `@1h 9/2x1:" i $"i#1dx q x0 |p@1'!p!p!p!p~ yxX@@11vpx08|~~ ~ " I1 q1h$@1x.x1q1x/x1pq1x/p1p1p I |~~~~ ~ "  I1ʭ 1p h&ppp@1Spp1 Ip |~~ ~ "  I1h `hklW/2~pp2,X'``p`pppvp 1 2,qp 2, H29x/ꤠklp Ip | 2Q2L|~ @2w2wH2j2k2_x2o#2_~2 |~2x2s2 `x x"2x$x" i5@h@2@2h0 @2!@2 @3o a6 `4@2`62`@2xp2x2x2x2x2 |x<x>2x@x>xH@2ӀxJ2x|x4x62x8x6 xD2 xF> @ e@2` @2`"@3(`,@x2|x(x*3'x,x*x03 x26#@3' "@3 3'# x| i5@h@32h<@3o``?````` Bgoxh@3Jhhh h3Txh`/`+,hx i5@ hyD3ji hx | 5O!d ixk`hX?``H``/`+h0@@3hK hH@3p3x3hK hH@3p3x3 p3x3hh hF 5h xLxJ | y5x4x3x3x3x3xGxK|  5F"2@3  "<@3 {*{.| 0 5F"2@3 9"<@3 '{6{:|  5F"<@4  {>{B| / 5F"2@4 9q"<@4 &&{"{&|:&zfJZ6**FښV:bΦֆުj~ھVjJNފ~Jb^rvzrҲ~R2 꺂nr>B^"Nb.:&zfJZ6Ʋʊ> "*Bf*&V6Fjzb:F2Z枦 VF&^>*N.~jJFrRvҾf>6^jzvV&֞Zºn~fֆJ6VjZj2NJ^vrvjVJҲ~R2 꺂nr>B^"Nb.:&zfJZ6ڮzbVYfj|Rf*&֊rvZFr^R~j nW 2  . zv"j~bή6V^gֺҚjNF j &bv^bZNҲ~R2 꺂nr>B^"Nb. !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"""""""""""""""""""""""""""""""##################$%%%%%&###################### !"""""""""""""""""""""""""""""""#################'''''''%%&###################(!)""""""""""""""""""""""""""""""""""""""""""""""*'%%%%%%%'+'',"""""""""""""""""# )"""""""""""""""""""""""""""""""(((((((((((((((%'''''''%-./''0(((((((((((((((#(!!"""""""""""""""""""""""""""""""#############"1'%%%%%%%'2342%%$"#############"# )"""""""""""""""""""""""""""""""#############"%'''''''%''%''''5#############(#(!!"""""""""""""6789:;<=>?@"""""""""""""""""""#"'%%%%%%%'%%'%%%%+A""""""""""""#"# )"""""""""""6BCDEFGHIHIJC;>K""""""((((((((((("'''-'''%''%-''''%1(((((((((((#(#(!!""""""""""7LHFMMMMFFFFMFNIO8P""""#########"""%%Q2Q%%'%3R&S%%%'T"##########"#"# )""""""""6UVGMMMGWXYZ[\]^MMFHY_""""#########""'+11`'%'R$a1+''%%T"#########(#(#(!!"""""""bcWMMMFdZefKbbKeghiMMFDU6"""""""""#"((%j1a"%'Q"k-lk%%''m""""""""""#"#"# )"""""""nHMMopq;f"""""""@rsWMMMt;"""((((((("""'a'."2446'2`"'%%'j(((((((((#(#(#(!!""""""e]MMuv>@"""""""""""@BXMMoh"""#####"##"(%A'-1wwxy%'2(%''%j"########"#"#"# )""""PbzGF{|f"""""""""""""""8}MM~""########"(%5/xx'k*%%'%5########(#(#(#(!!""""e\Mu""""""""C>b#>P""""MtK@"#######(6"'-'%`'%k#####(#(#(#(#(!!"""<~b"""""""CU@"""""#"""@zM"6"""#"((""#"%'1%''-"""""#"#"#"#"# )"""I|"""""""K!U6""""""""""")MN""(((""####6%-11$*4'-/%'R(((#(#(#(#(#(!!"""NJ""""""">f"""""""""""cM^"(#"###(#"@y'-a1101*6(y%%''%%$##"#"#"#"#"# )"""9N?"""""""9b""""""""e"""gM"#######((##%%Ay0111$l6""6%%'''5#(#(#(#(#(#(!!""6:\"""""""ghf"""""""""""")~C@""#"((""#"-'`"6y111*66"#(""''%%%'A#"#"#"#"#"# )""6Z""""""""!]e""""""b@""Kv9@((""####3%%6@666yb""#""#""+'''%%%"(#(#(#(#(!!""":E)""""""""}=""""b@76"6!HL7"#"###(#"0''####@6""##(###"5%%%'''/"#"#"#"#"# )""":q""""""""U|"""bB""""e>b"#####(($%%%1"####y(#(##((lya''%%%''/"(#(#(#(!!""":X"""""""zr"""""##"(("""$'4'$6"("#("("#(####@"(6"2&%%%''1"#"#"# )"""fVMME""""""""""#f?""""""(((""##(6&2'-"####"#"#""#(###"""""*-''4%%'.*(#(#(!!""""MM~6"""""""""""""""""""""###(#""'S%1##"((#(##(#("#(####("(%%%S''%-$#"#"# )""""HMM?"""""""""""""""""""#####(#"'-'6(##"###(##"#(""(###("6''%S%'%'1(#(#(!!"""""L^Mu"""""""""""""""""""#"(("""l%2%Q#"("#("("#(##"#(#((""#"%%'Q'%'%T#"#"# )"""""\MMt<""""""""""""""""""(""##("4'-'k####"#"#""#(###"""##"""-%'S'%'%5"(#(!!""""""BWMFO?"""""""""""""""""###(#"*%%Q%A#"((#(##(#("#(####(#(#(S'%Q%'%'5*"#"# )"""""""}M~C?""""""""""""""""###(""1''4%*(""###(##"#(""(###(#(""Q'''%'%'5("(#(!!"""""""@dMi"""""""""""""""((""#(%%%-l"##("("#(##"#(#((""#"#"-%S%-'%'5"##"# )""""""""6_\op6""""""""""""""##("(*%$"#"#"#""#(###"""##"##""'%'%%'3'j6#(#(!!""""""""""7c{Cf""""""""""""#(#"#"a'A(#(##(#("#(####(#(#w'%'''&2T#"#"# )""""""""""""bMH"@##""#@@####@"#$1TTk6#@##(#"(#(!!"""""""""""""l&'+""""""""""l%'"""#(""#ciMM"#"#########@#@#@#""@#"#("""(#"# )""""""""""""""'"""""""""""%'""""""""r[iV"""""""""""""""""""""""""""""""" !""""""""""""""3'4"""""""""""m'"""""""""r9"""""""""""""""""""""""""""""""""!)""""""""""('&"""((""'"(("""""""(""""㫫"""""""""(""""""""" !"""""""&'&""'Ʈ,""m"(Rm""m,("""""""!)""""""2'''''''/''%'''é'''%`""&%'''''(2-R''''""""""" !""""""'m2'&''4T0%%'-''%ϫ''"2,'Q"'/3''"""""""!)""""""'',(((/'&'%(""%'+-'-''"('-"`'ϫ(Q'%""""""" !""""""''""""/'ة'-"""+''+""''0''"""""""b'-"'""/'%"""""""!)""""""''""""`''2"""+''"""''''"""ڮ'"l'2""'%""""""" !""""""''""""`'&'/''"""''''"/&444-'-"'2l""''"""""""!)""""""'%""""`'&'''"""''''l'+'-"l'2""''""""""" !""""""''""""''TTT'"""(''''l&'Q""'-"l'l""'%"""""""!)""""""''""""&'3'"""""""'""",''A''lQ'"""'-"l'2""''""""""" !""""""''("""'&'"""""""'"""''''3"""'-"'l""'%"""""""!)""""""''`""(+'&,'"""""""'"""3'.'''"""'-"/'2""''""""""" !""""""''%׮-'A''(('"""A"3''AQ''-"`'l""'%"""""""!)""""""''+'+'%&R%'Ʃ"l''/'%QQ'"'2""`''""""""" !""""""%''''/'(4%'''''T%'2-'`""''('''%''0"4'2""4''"""""""!)"""""""lRR"(,l"""ܮ"(0"0l""(00l""""""" !)))))) !!))!!! !!!) !) !))!! )))! ))) )! )!)!!!! ! !!) )!!))!!)!!))))))))!255 20u>+YybT ##"22##"22##"22#########################$DDDDDDDDDDDDDDDDDDDDDDDDVfftDDDDDDDDDDB$DDDDDDDDDDDDDDDDDDDDDDDFfffftDDDDDDDDDC4DDDDDDDDDDDDDDDDDDDDDDHffffgfDDDDDDDDB$DDDDDDDDDDDDDDDDDDDDDDFffffivjDDDDDDDDC4DDDDDDDDDDDDDDDDDDDDDDffffiwfTDDDDDDDB$DDDDDDDDDDDDDDDDDDDDDDffffffffDDDDDDDC4DDDDDDHU(DDDDDDDDDDDffffffffuDDDDDDDB$DDDDDH;8DDDDDDDDDffffffffjDDDDDDDC4DDDDD<ܻTDDDDDDDDfvvfivfjDDDDDDDB$DDDD[۳3TDDDDDDDgvfvfjDDDDDDDC4DDDB8DD+ݵDDDDDDDbFgJh&fiDDDDDDDB$DDD,8DDDDD+ۄDDDDDDeiFwFwFfjDDDDDDDC4DDH8DDDDDDEܴDDDDDDefWwfFfiDDDDDDDB$DDCݵDDDDDDD\DDDDDDiwjfiDDDDDDDC4DH˄DDDDDDDDCDDDDDDgvfiDDDDDDDB$DDDDDDDDDDH(DDDDDDgfgDDDDDDDC4DE$DDDDS3"DDDDDDDDiOffDDDDDDDB$D̄DDDETDDD=DDDDDDfgfDDDDDDC4DDDDDTDDDDD=DDDDDDf)idDDDDDDB$D\DDDD5DDDDDD-DDDDDDffviDDDDDDC4D\DDDH4DDDDD-DDDDDDf)DfffTDDDDDB$D,DDDJ8DDDDDD-DDDDDFeJ*XDDffDDDDDC4D+DDDBDDDDDD<4DDDDDftHDDDFffeDDDDDB$D4DDDCDDDHDD$DDDDIfDDHDDDDGfffDDDDC4D,$DDDBDDDHDBDDDDDiDDDDDDDIffftDDDDB$D4DDDEDDXDDDDDEfjDDHDDDHEfffgDDDDC4D,DDDH3DDDDH;DDDDfiXDDDUffff(DDDB$D\DDDHS$DDD;DDDDD&fzDDDDDDUwffjDDDC4DDDDDB3ÄDDDDDfvDDDDDDDHfvfiDDB$D\ӄDDDD;3$DDDDDDffDDDDDDDDDfwfgTDDC4DܸDDDDH3:DDDDDDDEgeDDDDDDDDDDvffDDB$DKDDDDDDDDDDDDDDGvdDDDDDDDDDDfvfDDC4DBDDDDDDDDDDDDDDFvDDDDDDDDDDFfvfeDDB$DDDDDDDDDDDDDDDDfDDDDDDDDDDDFfvfjDDC4DD?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|%}~$,8x({4. !e ^# +" '* $+$ +$ '* $p 1Q "p00@@PP``p0`@p  @|,l